PDB entry 1t0v

View 1t0v on RCSB PDB site
Description: NMR Solution Structure of the Engineered Lipocalin FluA(R95K) Northeast Structural Genomics Target OR17
Class: ligand binding protein
Keywords: PIERIS BRASSICAE, LIPOCALIN, ANTICALIN, PROTEIN ENGINEERING, BETA-BARREL, LIGAND BINDING PROTEIN, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2004-04-13, released 2005-06-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-04-07, with a file datestamp of 2010-04-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bilin-binding protein
    Species: Pieris brassicae [TaxId:7116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09464 (0-173)
      • see remark 999 (0)
      • see remark 999 (20)
      • see remark 999 (33-36)
      • see remark 999 (57)
      • see remark 999 (59)
      • see remark 999 (68)
      • see remark 999 (86-87)
      • see remark 999 (89)
      • see remark 999 (92)
      • see remark 999 (95-96)
      • see remark 999 (113)
      • see remark 999 (115)
      • see remark 999 (124)
      • see remark 999 (126)
      • see remark 999 (134)
      • see remark 999 (174-183)
    Domains in SCOPe 2.08: d1t0va1, d1t0va2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t0vA (A:)
    dvyhdgacpevkpvdnfdwsqyhgkwwevakypspngkygkcgwaeytpegksvkvsryd
    vihgkeyfmegtaypvgdskigkiyhsrtvggytkktvfnvlstdnknyiigyscryded
    kkghwdhvwvlsrsmvltgeaktavenyligspvvdsqklvysdfseaackvnnsnwshp
    qfek