PDB entry 1t0o

View 1t0o on RCSB PDB site
Description: the structure of alpha-galactosidase from trichoderma reesei complexed with beta-d-galactose
Deposited on 2004-04-12, released 2004-10-12
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-12, with a file datestamp of 2004-10-12.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.157
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t0oA (A:)
    ivmpdgvtgkvpslgwnswnayhcdideskflsaaelivssglldagynyvniddcwsmk
    dgrvdghiapnatrfpdgidglakkvhalglklgiystagtatcagypaslgyedvdaad
    fadwgvdylkydncnvpsdwqdeyvacnpdfvktgpngtcttaldptlappgydwstsks
    aerfgamrnalakqsheivlsmciwgqadvfswgnstgiswrmsddispnwgsvtrilnl
    nsfklnsvdfwghndadmlevgngnltaaetrthfalwaamksplligtdlaqlsqnnin
    llknkhllafnqdsvygqpatpykwginpdwtfnvtypaefwagpsskghlvlmvntldi
    tatkeakwneipglsaghyevrdvwsdkdlgclssykaavaahdtavilvgkkcqrw