PDB entry 1t0l

View 1t0l on RCSB PDB site
Description: Crystal structure of human cytosolic NADP(+)-dependent isocitrate dehydrogenase in complex with NADP, isocitrate, and calcium(2+)
Class: Oxidoreductase
Keywords: Rossmann fold, NADP, isocitrate, calcium, quaternary complex
Deposited on 2004-04-10, released 2004-06-15
The last revision prior to the SCOP 1.75 freeze date was dated 2004-09-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: 0.214
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: isocitrate dehydrogenase [nadp] cytoplasmic
    Species: HOMO SAPIENS
    Gene: IDH
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1t0la_
  • Chain 'B':
    Compound: isocitrate dehydrogenase [nadp] cytoplasmic
    Species: HOMO SAPIENS
    Gene: IDH
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1t0lb_
  • Chain 'C':
    Compound: isocitrate dehydrogenase [nadp] cytoplasmic
    Species: HOMO SAPIENS
    Gene: IDH
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1t0lc_
  • Chain 'D':
    Compound: isocitrate dehydrogenase [nadp] cytoplasmic
    Species: HOMO SAPIENS
    Gene: IDH
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1t0ld_
  • Heterogens: CA, NAP, ICT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t0lA (A:)
    mskkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkda
    aeaikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprl
    vsgwvkpiiigrhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvam
    gmynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfe
    aqkiwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdg
    ktveaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanale
    evsietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqakl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t0lB (B:)
    mskkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkda
    aeaikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprl
    vsgwvkpiiigrhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvam
    gmynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfe
    aqkiwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdg
    ktveaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanale
    evsietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqakl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t0lC (C:)
    mskkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkda
    aeaikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprl
    vsgwvkpiiigrhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvam
    gmynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfe
    aqkiwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdg
    ktveaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanale
    evsietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqakl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t0lD (D:)
    mskkisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkda
    aeaikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprl
    vsgwvkpiiigrhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvam
    gmynqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfe
    aqkiwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdg
    ktveaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanale
    evsietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkiklaqakl