PDB entry 1t0k

View 1t0k on RCSB PDB site
Description: Joint X-ray and NMR Refinement of Yeast L30e-mRNA complex
Class: ribosome
Keywords: Joint NMR and X-ray refinement, Ribosomal Protein L30e, MBP fusion protein, RIBOSOME
Deposited on 2004-04-09, released 2004-07-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.24 Å
R-factor: 0.261
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Maltose-binding periplasmic protein
    Species: Escherichia coli [TaxId:562]
    Gene: MALE, B4034, Z5632, ECS5017
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02928 (Start-366)
      • cloning artifact (367-369)
    Domains in SCOPe 2.06: d1t0ka1, d1t0ka2
  • Chain 'B':
    Compound: 60s ribosomal protein l30
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: RPL30, RPL32, YGL030W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1t0kb_
  • Chain 'C':
    Compound: 5'-r(*gp*ap*cp*cp*gp*gp*ap*gp*up*gp*up*cp*c)-3'
  • Chain 'D':
    Compound: 5'-r(*g*gp*ap*cp*gp*cp*ap*gp*ap*gp*ap*up*gp*gp*up*c)-3'
  • Heterogens: MTT

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t0kA (A:)
    mkleegklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdi
    ifwahdrfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynk
    dllpnppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydik
    dvgvdnagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtsk
    vnygvtvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkpl
    gavalksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvde
    alkdaqtnsssvpgrgsiegr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0kA (A:)
    gklviwingdkgynglaevgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwah
    drfggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllpn
    ppktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgvd
    nagakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnygv
    tvlptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgaval
    ksyeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkda
    qtnss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t0kB (B:)
    mapvksqesinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyya
    mlsktkvyyfqggnnelgtavgklfrvgvvsileagdsdilttla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0kB (B:)
    sinqklalviksgkytlgykstvkslrqgkskliiiaantpvlrkseleyyamlsktkvy
    yfqggnnelgtavgklfrvgvvsileagdsdilttla
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.