PDB entry 1t0j

View 1t0j on RCSB PDB site
Description: Crystal structure of a complex between voltage-gated calcium channel beta2a subunit and a peptide of the alpha1c subunit
Class: signaling protein
Keywords: SH3 domain, nucleotide kinase like domain, ion channel, calcium channel, AID
Deposited on 2004-04-09, released 2004-06-15
The last revision prior to the SCOP 1.75 freeze date was dated 2005-12-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: voltage-gated calcium channel subunit beta2a
    Species: Rattus norvegicus
    Gene: CACNB2A
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1t0ja_
  • Chain 'B':
    Compound: voltage-gated calcium channel subunit beta2a
    Species: Rattus norvegicus
    Gene: CACNB2A
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1t0jb_
  • Chain 'C':
    Compound: Voltage-dependent L-type calcium channel alpha-1C subunit
    Species: HOMO SAPIENS
    Gene: CACNA1C, CACNL1A1, CCHL1A1, CACH2, CACN2
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1t0jc_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t0jA (A:)
    ghmgsadsytsrpsdsdvsleedreavrreaerqaqaqlekaktkpvafavrtnvrysaa
    qeddvpvpgmaisfeakdflhvkekfnndwwigrlvkegceigfipspvklenmrlqheq
    rakqgkfyssks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0jA (A:)
    rreaerqaqaqlekaktkpvafavrtnvrysaaqeddvpvpgmaisfeakdflhvkekfn
    ndwwigrlvkegceigfipspvklenmrlqheqrak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t0jB (B:)
    mskekrmpffkktehtppydvvpsmrpvvlvgpslkgyevtdmmqkalfdflkhrfegri
    sitrvtadislakrsvlnnpskhaiiersntrsslaevqseierifelartlqlvvldad
    tinhpaqlsktslapiivyvkisspkvlqrliksrgksqakhlnvqmvaadklaqcppqe
    sfdvildenqledacehladyleaywkathppssnlpnpllsrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0jB (B:)
    ftppydvvpsmrpvvlvgpslkgyevtdmmqkalfdflkhrfegrisitrvtadislaka
    iiersntrsslaevqseierifelartlqlvvldadtinhpaqlsktslapiivyvkiss
    pkvlqrliksrhlnvqmvaadklaqcppqesfdvildenqledacehladyleaywkath
    ppssnrt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t0jC (C:)
    gaqqleedlkgyldwitqae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0jC (C:)
    qqleedlkgyldwitq