PDB entry 1t0j

View 1t0j on RCSB PDB site
Description: Crystal structure of a complex between voltage-gated calcium channel beta2a subunit and a peptide of the alpha1c subunit
Deposited on 2004-04-09, released 2004-06-15
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-15, with a file datestamp of 2004-06-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1t0ja_
  • Chain 'B':
    Domains in SCOP 1.69: d1t0jb_
  • Chain 'C':
    Domains in SCOP 1.69: d1t0jc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t0jA (A:)
    ghmgsadsytsrpsdsdvsleedreavrreaerqaqaqlekaktkpvafavrtnvrysaa
    qeddvpvpgmaisfeakdflhvkekfnndwwigrlvkegceigfipspvklenmrlqheq
    rakqgkfyssks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0jA (A:)
    rreaerqaqaqlekaktkpvafavrtnvrysaaqeddvpvpgmaisfeakdflhvkekfn
    ndwwigrlvkegceigfipspvklenmrlqheqrak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t0jB (B:)
    mskekrmpffkktehtppydvvpsmrpvvlvgpslkgyevtdmmqkalfdflkhrfegri
    sitrvtadislakrsvlnnpskhaiiersntrsslaevqseierifelartlqlvvldad
    tinhpaqlsktslapiivyvkisspkvlqrliksrgksqakhlnvqmvaadklaqcppqe
    sfdvildenqledacehladyleaywkathppssnlpnpllsrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0jB (B:)
    ftppydvvpsmrpvvlvgpslkgyevtdmmqkalfdflkhrfegrisitrvtadislaka
    iiersntrsslaevqseierifelartlqlvvldadtinhpaqlsktslapiivyvkiss
    pkvlqrliksrhlnvqmvaadklaqcppqesfdvildenqledacehladyleaywkath
    ppssnrt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t0jC (C:)
    gaqqleedlkgyldwitqae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0jC (C:)
    qqleedlkgyldwitq