PDB entry 1t0i

View 1t0i on RCSB PDB site
Description: YLR011wp, a Saccharomyces cerevisiae NA(D)PH-dependent FMN reductase
Class: Oxidoreductase
Keywords: Saccharomyces cerevisiae, FMN binding protein, Flavodoxin, Azoreductase, Oxidoreductase
Deposited on 2004-04-09, released 2004-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.202
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: YLR011wp
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YLR011w
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t0ia_
  • Chain 'B':
    Compound: YLR011wp
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: YLR011w
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t0ib_
  • Heterogens: CA, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t0iA (A:)
    mkvgiimgsvrakrvcpeiaayvkrtienseelidqklkiqvvdlqqialplyedddeli
    paqiksvdeyadsktrswsrivnaldiivfvtpqynwgypaalknaidrlyhewhgkpal
    vvsygghggskcndqlqevlhglkmnviggvavkipvgtiplpedivpqlsvhneeilql
    lasciettrnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0iA (A:)
    mkvgiimgsvrakrvcpeiaayvkrtienseelidqklkiqvvdlqqialplyedddeli
    paqiksvdeyadsktrswsrivnaldiivfvtpqynwgypaalknaidrlyhewhgkpal
    vvsygghggskcndqlqevlhglkmnviggvavkipvgtiplpedivpqlsvhneeilql
    lasci
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t0iB (B:)
    mkvgiimgsvrakrvcpeiaayvkrtienseelidqklkiqvvdlqqialplyedddeli
    paqiksvdeyadsktrswsrivnaldiivfvtpqynwgypaalknaidrlyhewhgkpal
    vvsygghggskcndqlqevlhglkmnviggvavkipvgtiplpedivpqlsvhneeilql
    lasciettrnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0iB (B:)
    kvgiimgsvrakrvcpeiaayvkrtienskiqvvdlqqialplyedddelipaqiksvde
    yadsktrswsrivnaldiivfvtpqynwgypaalknaidrlyhewhgkpalvvsygghgg
    skcndqlqevlhglkmnviggvavkipvgtiplpedivpqlsvhneeilqllascie