PDB entry 1t0h

View 1t0h on RCSB PDB site
Description: Crystal structure of the Rattus norvegicus voltage gated calcium channel beta subunit isoform 2a
Class: signaling protein
Keywords: SH3 domain, Nucleotide kinase like domain
Deposited on 2004-04-08, released 2004-06-15
The last revision prior to the SCOP 1.75 freeze date was dated 2005-12-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.187
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: voltage-gated calcium channel subunit beta2a
    Species: Rattus norvegicus
    Gene: CACNB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VGC3
      • modified residue (69)
      • modified residue (113)
    Domains in SCOP 1.75: d1t0ha_
  • Chain 'B':
    Compound: voltage-gated calcium channel subunit beta2a
    Species: Rattus norvegicus
    Gene: CACNB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8VGC3 (Start-223)
      • modified residue (6)
      • modified residue (24)
      • modified residue (42-43)
      • modified residue (166)
    Domains in SCOP 1.75: d1t0hb_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t0hA (A:)
    ghmgsadsytsrpsdsdvsleedreavrreaerqaqaqlekaktkpvafavrtnvrysaa
    qeddvpvpgmaisfeakdflhvkekfnndwwigrlvkegceigfipspvklenmrlqheq
    rakqgkfyssks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0hA (A:)
    rreaerqaqaqlekaktkpvafavrtnvrysaaqeddvpvpgmaisfeakdflhvkekfn
    ndwwigrlvkegceigfipspvklenmrlqheqrak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t0hB (B:)
    mskekrmpffkktehtppydvvpsmrpvvlvgpslkgyevtdmmqkalfdflkhrfegri
    sitrvtadislakrsvlnnpskhaiiersntrsslaevqseierifelartlqlvvldad
    tinhpaqlsktslapiivyvkisspkvlqrliksrgksqakhlnvqmvaadklaqcppqe
    sfdvildenqledacehladyleaywkathppssnlpnpllsrt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0hB (B:)
    rmpftppydvvpsmrpvvlvgpslkgyevtdmmqkalfdflkhrfegrisitrvtadisl
    akaiiersntrsslaevqseierifelartlqlvvldadtinhpaqlsktslapiivyvk
    isspkvlqrliksrhlnvqmvaadklaqcppqesfdvildenqledacehladyleaywk
    athpprt