PDB entry 1t0g

View 1t0g on RCSB PDB site
Description: hypothetical protein at2g24940.1 from arabidopsis thaliana has a cytochrome b5 like fold
Deposited on 2004-04-08, released 2004-04-13
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-13, with a file datestamp of 2004-04-13.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1t0ga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t0gA (A:)
    mghhhhhhleeftaeqlsqyngtdeskpiyvaikgrvfdvttgksfygsggdysmfagkd
    asralgkmskneedvspslegltekeintlndwetkfeakypvvgrvvs