PDB entry 1t0g

View 1t0g on RCSB PDB site
Description: Hypothetical protein At2g24940.1 from Arabidopsis thaliana has a cytochrome b5 like fold
Class: structural genomics, unknown function
Keywords: structural genomics, hypothetical protein, At2g24940.1, PSI, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, CESG, UNKNOWN FUNCTION
Deposited on 2004-04-08, released 2004-04-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-05, with a file datestamp of 2020-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome b5 domain-containing protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At2g24940.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9SK39 (9-108)
      • cloning artifact (1)
      • expression tag (2-7)
      • cloning artifact (8-9)
    Domains in SCOPe 2.08: d1t0ga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t0gA (A:)
    mghhhhhhleeftaeqlsqyngtdeskpiyvaikgrvfdvttgksfygsggdysmfagkd
    asralgkmskneedvspslegltekeintlndwetkfeakypvvgrvvs