PDB entry 1t0b

View 1t0b on RCSB PDB site
Description: Structure of ThuA-like protein from Bacillus stearothermophilus
Class: structural genomics, unknown function
Keywords: trehalose metabolism, NCS symmetry, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2004-04-08, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ThuA-like protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • PDB 1T0B
    Domains in SCOPe 2.07: d1t0ba_
  • Chain 'B':
    Compound: ThuA-like protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • PDB 1T0B
    Domains in SCOPe 2.07: d1t0bb_
  • Chain 'C':
    Compound: ThuA-like protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • PDB 1T0B
    Domains in SCOPe 2.07: d1t0bc_
  • Chain 'D':
    Compound: ThuA-like protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • PDB 1T0B
    Domains in SCOPe 2.07: d1t0bd_
  • Chain 'E':
    Compound: ThuA-like protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • PDB 1T0B
    Domains in SCOPe 2.07: d1t0be_
  • Chain 'F':
    Compound: ThuA-like protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • PDB 1T0B
    Domains in SCOPe 2.07: d1t0bf_
  • Chain 'G':
    Compound: ThuA-like protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • PDB 1T0B
    Domains in SCOPe 2.07: d1t0bg_
  • Chain 'H':
    Compound: ThuA-like protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • PDB 1T0B
    Domains in SCOPe 2.07: d1t0bh_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t0bA (A:)
    snamttpirvvvwnefrhekkdeqvraiypegmhtviasylaeagfdaatavldepehgl
    tdevldrcdvlvwwghiahdevkdevvervhrrvlegmglivlhsghfskifkklmgttc
    nlkwreadekerlwvvapghpivegigpyieleqeemygeffdipepdetifiswfegge
    vfrsgctftrgkgkifyfrpghetyptyhhpdvlkvianavrwaapvnrgeivfgnvkpl
    epikakqggvtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0bA (A:)
    tpirvvvwnefrhekkdeqvraiypegmhtviasylaeagfdaatavldepehgltdevl
    drcdvlvwwghiahdevkdevvervhrrvlegmglivlhsghfskifkklmgttcnlkwr
    eadekerlwvvapghpivegigpyieleqeemygeffdipepdetifiswfeggevfrsg
    ctftrgkgkifyfrpghetyptyhhpdvlkvianavrwaapvnrgeivfgnvkplepika
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t0bB (B:)
    snamttpirvvvwnefrhekkdeqvraiypegmhtviasylaeagfdaatavldepehgl
    tdevldrcdvlvwwghiahdevkdevvervhrrvlegmglivlhsghfskifkklmgttc
    nlkwreadekerlwvvapghpivegigpyieleqeemygeffdipepdetifiswfegge
    vfrsgctftrgkgkifyfrpghetyptyhhpdvlkvianavrwaapvnrgeivfgnvkpl
    epikakqggvtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0bB (B:)
    tpirvvvwnefrhekkdeqvraiypegmhtviasylaeagfdaatavldepehgltdevl
    drcdvlvwwghiahdevkdevvervhrrvlegmglivlhsghfskifkklmgttcnlkwr
    eadekerlwvvapghpivegigpyieleqeemygeffdipepdetifiswfeggevfrsg
    ctftrgkgkifyfrpghetyptyhhpdvlkvianavrwaapvnrgeivfgnvkplepika
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t0bC (C:)
    snamttpirvvvwnefrhekkdeqvraiypegmhtviasylaeagfdaatavldepehgl
    tdevldrcdvlvwwghiahdevkdevvervhrrvlegmglivlhsghfskifkklmgttc
    nlkwreadekerlwvvapghpivegigpyieleqeemygeffdipepdetifiswfegge
    vfrsgctftrgkgkifyfrpghetyptyhhpdvlkvianavrwaapvnrgeivfgnvkpl
    epikakqggvtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0bC (C:)
    tpirvvvwnefrhekkdeqvraiypegmhtviasylaeagfdaatavldepehgltdevl
    drcdvlvwwghiahdevkdevvervhrrvlegmglivlhsghfskifkklmgttcnlkwr
    eadekerlwvvapghpivegigpyieleqeemygeffdipepdetifiswfeggevfrsg
    ctftrgkgkifyfrpghetyptyhhpdvlkvianavrwaapvnrgeivfgnvkplepika
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1t0bD (D:)
    snamttpirvvvwnefrhekkdeqvraiypegmhtviasylaeagfdaatavldepehgl
    tdevldrcdvlvwwghiahdevkdevvervhrrvlegmglivlhsghfskifkklmgttc
    nlkwreadekerlwvvapghpivegigpyieleqeemygeffdipepdetifiswfegge
    vfrsgctftrgkgkifyfrpghetyptyhhpdvlkvianavrwaapvnrgeivfgnvkpl
    epikakqggvtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0bD (D:)
    tpirvvvwnefrhekkdeqvraiypegmhtviasylaeagfdaatavldepehgltdevl
    drcdvlvwwghiahdevkdevvervhrrvlegmglivlhsghfskifkklmgttcnlkwr
    eadekerlwvvapghpivegigpyieleqeemygeffdipepdetifiswfeggevfrsg
    ctftrgkgkifyfrpghetyptyhhpdvlkvianavrwaapvnrgeivfgnvkplepika
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1t0bE (E:)
    snamttpirvvvwnefrhekkdeqvraiypegmhtviasylaeagfdaatavldepehgl
    tdevldrcdvlvwwghiahdevkdevvervhrrvlegmglivlhsghfskifkklmgttc
    nlkwreadekerlwvvapghpivegigpyieleqeemygeffdipepdetifiswfegge
    vfrsgctftrgkgkifyfrpghetyptyhhpdvlkvianavrwaapvnrgeivfgnvkpl
    epikakqggvtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0bE (E:)
    tpirvvvwnefrhekkdeqvraiypegmhtviasylaeagfdaatavldepehgltdevl
    drcdvlvwwghiahdevkdevvervhrrvlegmglivlhsghfskifkklmgttcnlkwr
    eadekerlwvvapghpivegigpyieleqeemygeffdipepdetifiswfeggevfrsg
    ctftrgkgkifyfrpghetyptyhhpdvlkvianavrwaapvnrgeivfgnvkplepika
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1t0bF (F:)
    snamttpirvvvwnefrhekkdeqvraiypegmhtviasylaeagfdaatavldepehgl
    tdevldrcdvlvwwghiahdevkdevvervhrrvlegmglivlhsghfskifkklmgttc
    nlkwreadekerlwvvapghpivegigpyieleqeemygeffdipepdetifiswfegge
    vfrsgctftrgkgkifyfrpghetyptyhhpdvlkvianavrwaapvnrgeivfgnvkpl
    epikakqggvtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0bF (F:)
    tpirvvvwnefrhekkdeqvraiypegmhtviasylaeagfdaatavldepehgltdevl
    drcdvlvwwghiahdevkdevvervhrrvlegmglivlhsghfskifkklmgttcnlkwr
    eadekerlwvvapghpivegigpyieleqeemygeffdipepdetifiswfeggevfrsg
    ctftrgkgkifyfrpghetyptyhhpdvlkvianavrwaapvnrgeivfgnvkplepika
    k
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1t0bG (G:)
    snamttpirvvvwnefrhekkdeqvraiypegmhtviasylaeagfdaatavldepehgl
    tdevldrcdvlvwwghiahdevkdevvervhrrvlegmglivlhsghfskifkklmgttc
    nlkwreadekerlwvvapghpivegigpyieleqeemygeffdipepdetifiswfegge
    vfrsgctftrgkgkifyfrpghetyptyhhpdvlkvianavrwaapvnrgeivfgnvkpl
    epikakqggvtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0bG (G:)
    tpirvvvwnefrhekkdeqvraiypegmhtviasylaeagfdaatavldepehgltdevl
    drcdvlvwwghiahdevkdevvervhrrvlegmglivlhsghfskifkklmgttcnlkwr
    eadekerlwvvapghpivegigpyieleqeemygeffdipepdetifiswfeggevfrsg
    ctftrgkgkifyfrpghetyptyhhpdvlkvianavrwaapvnrgeivfgnvkplepika
    kq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1t0bH (H:)
    snamttpirvvvwnefrhekkdeqvraiypegmhtviasylaeagfdaatavldepehgl
    tdevldrcdvlvwwghiahdevkdevvervhrrvlegmglivlhsghfskifkklmgttc
    nlkwreadekerlwvvapghpivegigpyieleqeemygeffdipepdetifiswfegge
    vfrsgctftrgkgkifyfrpghetyptyhhpdvlkvianavrwaapvnrgeivfgnvkpl
    epikakqggvtq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0bH (H:)
    tpirvvvwnefrhekkdeqvraiypegmhtviasylaeagfdaatavldepehgltdevl
    drcdvlvwwghiahdevkdevvervhrrvlegmglivlhsghfskifkklmgttcnlkwr
    eadekerlwvvapghpivegigpyieleqeemygeffdipepdetifiswfeggevfrsg
    ctftrgkgkifyfrpghetyptyhhpdvlkvianavrwaapvnrgeivfgnvkplepika
    k