PDB entry 1t0a

View 1t0a on RCSB PDB site
Description: Crystal Structure of 2C-Methyl-D-Erythritol-2,4-cyclodiphosphate Synthase from Shewanella Oneidensis
Deposited on 2004-04-08, released 2004-10-26
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-26, with a file datestamp of 2004-10-26.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.175
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1t0aa_
  • Chain 'B':
    Domains in SCOP 1.71: d1t0ab_
  • Chain 'C':
    Domains in SCOP 1.71: d1t0ac_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t0aA (A:)
    mkirighgfdvhkfgeprplilcgvevpyetglvahsdgdvvlhaisdailgamalgdig
    khfpdtdaaykgadsrvllrhcyalakakgfelgnldvtiiaqapkmaphiedmrqvlaa
    dlnadvadinvkattteklgftgrkegiaveavvllsrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0aA (A:)
    kirighgfdvhkfgeprplilcgvevpyetglvahsdgdvvlhaisdailgamalgdigk
    hfpdtdaaykgadsrvllrhcyalakakgfelgnldvtiiaqapkmaphiedmrqvlaad
    lnadvadinvkattteklgftgrkegiaveavvllsrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t0aB (B:)
    mkirighgfdvhkfgeprplilcgvevpyetglvahsdgdvvlhaisdailgamalgdig
    khfpdtdaaykgadsrvllrhcyalakakgfelgnldvtiiaqapkmaphiedmrqvlaa
    dlnadvadinvkattteklgftgrkegiaveavvllsrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0aB (B:)
    kirighgfdvhkfgeprplilcgvevpyetglvahsdgdvvlhaisdailgamalgdigk
    hfpdtdaaykgadsrvllrhcyalakakgfelgnldvtiiaqapkmaphiedmrqvlaad
    lnadvadinvkattteklgftgrkegiaveavvllsrq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t0aC (C:)
    mkirighgfdvhkfgeprplilcgvevpyetglvahsdgdvvlhaisdailgamalgdig
    khfpdtdaaykgadsrvllrhcyalakakgfelgnldvtiiaqapkmaphiedmrqvlaa
    dlnadvadinvkattteklgftgrkegiaveavvllsrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0aC (C:)
    kirighgfdvhkfgeprplilcgvevpyetglvahsdgdvvlhaisdailgamalgdigk
    hfpdtdaaykgadsrvllrhcyalakakgfelgnldvtiiaqapkmaphiedmrqvlaad
    lnadvadinvkattteklgftgrkegiaveavvllsrq