PDB entry 1t0a

View 1t0a on RCSB PDB site
Description: Crystal Structure of 2C-Methyl-D-Erythritol-2,4-cyclodiphosphate Synthase from Shewanella Oneidensis
Class: lyase
Keywords: mixed alpha beta, homotrimer, synthase, LYASE
Deposited on 2004-04-08, released 2004-10-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.175
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase
    Species: Shewanella oneidensis [TaxId:211586]
    Gene: ISPF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EBR3 (Start-158)
      • modified residue (53)
      • modified residue (106)
      • modified residue (113)
    Domains in SCOPe 2.08: d1t0aa_
  • Chain 'B':
    Compound: 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase
    Species: Shewanella oneidensis [TaxId:211586]
    Gene: ISPF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EBR3 (Start-158)
      • modified residue (53)
      • modified residue (106)
      • modified residue (113)
    Domains in SCOPe 2.08: d1t0ab_
  • Chain 'C':
    Compound: 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase
    Species: Shewanella oneidensis [TaxId:211586]
    Gene: ISPF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EBR3 (Start-158)
      • modified residue (53)
      • modified residue (106)
      • modified residue (113)
    Domains in SCOPe 2.08: d1t0ac_
  • Heterogens: ZN, CO, FPP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t0aA (A:)
    mkirighgfdvhkfgeprplilcgvevpyetglvahsdgdvvlhaisdailgamalgdig
    khfpdtdaaykgadsrvllrhcyalakakgfelgnldvtiiaqapkmaphiedmrqvlaa
    dlnadvadinvkattteklgftgrkegiaveavvllsrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0aA (A:)
    kirighgfdvhkfgeprplilcgvevpyetglvahsdgdvvlhaisdailgamalgdigk
    hfpdtdaaykgadsrvllrhcyalakakgfelgnldvtiiaqapkmaphiedmrqvlaad
    lnadvadinvkattteklgftgrkegiaveavvllsrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t0aB (B:)
    mkirighgfdvhkfgeprplilcgvevpyetglvahsdgdvvlhaisdailgamalgdig
    khfpdtdaaykgadsrvllrhcyalakakgfelgnldvtiiaqapkmaphiedmrqvlaa
    dlnadvadinvkattteklgftgrkegiaveavvllsrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0aB (B:)
    kirighgfdvhkfgeprplilcgvevpyetglvahsdgdvvlhaisdailgamalgdigk
    hfpdtdaaykgadsrvllrhcyalakakgfelgnldvtiiaqapkmaphiedmrqvlaad
    lnadvadinvkattteklgftgrkegiaveavvllsrq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1t0aC (C:)
    mkirighgfdvhkfgeprplilcgvevpyetglvahsdgdvvlhaisdailgamalgdig
    khfpdtdaaykgadsrvllrhcyalakakgfelgnldvtiiaqapkmaphiedmrqvlaa
    dlnadvadinvkattteklgftgrkegiaveavvllsrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t0aC (C:)
    kirighgfdvhkfgeprplilcgvevpyetglvahsdgdvvlhaisdailgamalgdigk
    hfpdtdaaykgadsrvllrhcyalakakgfelgnldvtiiaqapkmaphiedmrqvlaad
    lnadvadinvkattteklgftgrkegiaveavvllsrq