PDB entry 1t08

View 1t08 on RCSB PDB site
Description: Crystal structure of beta-catenin/ICAT helical domain/unphosphorylated APC R3
Class: cell adhesion/cell cycle
Keywords: beta-catenin; Wnt signal; APC; 20mer repeat; Wnt signaling, cell adhesion/cell cycle COMPLEX
Deposited on 2004-04-07, released 2004-10-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.204
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-catenin
    Species: Homo sapiens [TaxId:9606]
    Gene: CTNNB1,CTNNB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1t08a_
  • Chain 'B':
    Compound: Beta-catenin-interacting protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CTNNBIP1,ICAT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1t08b_
  • Chain 'C':
    Compound: adenomatous polyposis coli protein
    Species: Homo sapiens [TaxId:9606]
    Gene: APC,DP2.5
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t08A (A:)
    aelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqnt
    ndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllh
    qegakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalv
    nimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtl
    rnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggie
    alvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwp
    likatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrrtsmggtqqqfvegvr
    meeivegctgalhilardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdk
    eaaeaieaegatapltellhsrnegvatyaaavlfrmse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t08A (A:)
    aelatraipeltkllndedqvvvnkaavmvhqlskkeasrhaimrspqmvsaivrtmqnt
    ndvetarctagtlhnlshhregllaifksggipalvkmlgspvdsvlfyaittlhnlllh
    qegakmavrlagglqkmvallnktnvkflaittdclqilaygnqeskliilasggpqalv
    nimrtytyekllwttsrvlkvlsvcssnkpaiveaggmqalglhltdpsqrlvqnclwtl
    rnlsdaatkqegmegllgtlvqllgsddinvvtcaagilsnltcnnyknkmmvcqvggie
    alvrtvlragdreditepaicalrhltsrhqeaemaqnavrlhyglpvvvkllhppshwp
    likatvglirnlalcpanhaplreqgaiprlvqllvrahqdtqrqfvegvrmeeivegct
    galhilardvhnrivirglntiplfvqllyspieniqrvaagvlcelaqdkeaaeaieae
    gatapltellhsrnegvatyaaavlfrmse
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t08B (B:)
    gkspeemyiqqkvrvllmlrkmgsnltaseeeflrtyagvvnsqls
    

  • Chain 'C':
    No sequence available.