PDB entry 1t07
View 1t07 on RCSB PDB site
Description: Crystal Structure of Conserved Protein of Unknown Function PA5148 from Pseudomonas aeruginosa
Class: Structural genomics, unknown function
Keywords: Structural genomics, APC5047, PA5148, Conserved hypothetical protein, Pseudomonas aeruginosa, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, unknown function
Deposited on
2004-04-07, released
2004-08-03
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.51
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Hypothetical UPF0269 protein PA5148
Species: Pseudomonas aeruginosa [TaxId:287]
Gene: PA5148
Database cross-references and differences (RAF-indexed):
- Uniprot Q9HU36 (2-End)
- cloning artifact (0-1)
- modified residue (2)
- modified residue (7)
- modified residue (49)
- modified residue (58-59)
- modified residue (71)
Domains in SCOPe 2.08: d1t07a1, d1t07a2 - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1t07A (A:)
ghmsrtvmcrkyheelpgldrppypgakgediynnvsrkawdewqkhqtmlinerrlnmm
naedrkflqqemdkflsgedyakadgyvppsags
Sequence, based on observed residues (ATOM records): (download)
>1t07A (A:)
ghmsrtvmcrkyheelpgldrppypgakgediynnvsrkawdewqkhqtmlinerrlnmm
naedrkflqqemdkflsgedy