PDB entry 1t06

View 1t06 on RCSB PDB site
Description: 1.9 A Crystal Structure of a Protein of Unknown Function from Bacillus cereus ATCC 14579
Class: structural genomics, unknown function
Keywords: hypothetical protein, Bacillus cereus, structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2004-04-07, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.196
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t06a_
  • Chain 'B':
    Compound: hypothetical protein
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1t06b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t06A (A:)
    mdfktvmqelealgkertkkiyisngahepvfgvatgamkpiakkiklnqelaeelyatg
    nydamyfagiiadpkamsesdfdrwidgayfymlsdyvvavtlsesniaqdvadkwiasg
    delkmsagwscycwllgnrkdnafseskisdmlemvkdtihhspertksamnnflntvai
    syvplhekaveiakevgivevkrdnkkssllnasesiqkeldrgrlgfkrkyvrc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t06B (B:)
    mdfktvmqelealgkertkkiyisngahepvfgvatgamkpiakkiklnqelaeelyatg
    nydamyfagiiadpkamsesdfdrwidgayfymlsdyvvavtlsesniaqdvadkwiasg
    delkmsagwscycwllgnrkdnafseskisdmlemvkdtihhspertksamnnflntvai
    syvplhekaveiakevgivevkrdnkkssllnasesiqkeldrgrlgfkrkyvrc