PDB entry 1t04

View 1t04 on RCSB PDB site
Description: Three dimensional structure of a humanized anti-IFN-Gamma Fab in C2 space group
Deposited on 2004-04-07, released 2004-10-05
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-19, with a file datestamp of 2004-10-19.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.217
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t04A (A:)
    diqmtqspstlsasvgdrvtitckasenvdtyvswyqqkpgkapklliygasnrytgvps
    rfsgsgsgtdftltisslqpddfatyycgqsynypftfgqgtkvevkrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t04B (B:)
    evqlvqsgaelkkpgssvkvsckasgyiftsswinwvkqapgqglewigridpsdgevhy
    nqdfkdkatltvdkstntaymelsslrsedtavyycargflpwfadwgqgtlvtvssast
    kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t04C (C:)
    diqmtqspstlsasvgdrvtitckasenvdtyvswyqqkpgkapklliygasnrytgvps
    rfsgsgsgtdftltisslqpddfatyycgqsynypftfgqgtkvevkrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1t04D (D:)
    evqlvqsgaelkkpgssvkvsckasgyiftsswinwvkqapgqglewigridpsdgevhy
    nqdfkdkatltvdkstntaymelsslrsedtavyycargflpwfadwgqgtlvtvssast
    kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
    slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks