PDB entry 1t02

View 1t02 on RCSB PDB site
Description: Crystal structure of a Statin bound to class II HMG-CoA reductase
Deposited on 2004-04-07, released 2004-08-03
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-03, with a file datestamp of 2004-08-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.196
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1t02A (A:)
    msldsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfel
    pyavasnfqingrdvlvplvveepsivaaasymaklaranggfttsssaplmhaqvqivg
    iqdplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprgpmlvahlivd
    vrdamgantvntmaeavaplmeaitggqvrlrilsnladlrlaraqvritpqqletaefs
    geaviegildayafaavdpyraathnkgimngidplivatgndwraveagahayacrsgh
    ygslttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaqalaeiavav
    glaqnlgamralategiqrghmalharniavvagargdevdwvarqlveyhdvradrava
    llkqkrgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t02A (A:)
    dsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfelpya
    vasnfqingrdvlvplvveepsivaaasymaklaranggfttsssaplmhaqvqivgiqd
    plnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprgpmlvahlivdvrd
    amgantvntmaeavaplmeaitggqvrlrilsnladlrlaraqvritpqqletaefsgea
    viegildayafaavdpyraathnkgimngidplivatgndwraveagahayacrsghygs
    lttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaqalaeiavavgla
    qnlgamralat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1t02B (B:)
    msldsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfel
    pyavasnfqingrdvlvplvveepsivaaasymaklaranggfttsssaplmhaqvqivg
    iqdplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprgpmlvahlivd
    vrdamgantvntmaeavaplmeaitggqvrlrilsnladlrlaraqvritpqqletaefs
    geaviegildayafaavdpyraathnkgimngidplivatgndwraveagahayacrsgh
    ygslttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaqalaeiavav
    glaqnlgamralategiqrghmalharniavvagargdevdwvarqlveyhdvradrava
    llkqkrgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1t02B (B:)
    dsrlpafrnlspaarldhigqllglshddvsllanagalpmdiangmienvigtfelpya
    vasnfqingrdvlvplvveepsivaaasymaklaranggfttsssaplmhaqvqivgiqd
    plnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprgpmlvahlivdvrd
    amgantvntmaeavaplmeaitggqvrlrilsnladlrlaraqvritpqqletaefsgea
    viegildayafaavdpyraathnkgimngidplivatgndwraveagahayacrsghygs
    lttwekdnnghlvgtlempmpvglvggatkthplaqlslrilgvktaqalaeiavavgla
    qnlgamralategi