PDB entry 1t01

View 1t01 on RCSB PDB site
Description: Vinculin complexed with the VBS1 helix from talin
Class: cell adhesion, structural protein
Keywords: five helix bundle, CELL ADHESION, STRUCTURAL PROTEIN
Deposited on 2004-04-07, released 2004-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.23
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: unnamed protein product
    Species: Gallus gallus [TaxId:9031]
    Gene: VCL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12003 (1-254)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1t01a1, d1t01a2, d1t01a3
  • Chain 'B':
    Compound: Talin 1
    Species: Mus musculus [TaxId:10090]
    Gene: Tln1, Tln
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1t01A (A:)
ampvfhtrtiesilepvaqqishlvimheegevdgkaipdltapvsavqaavsnlvrvgk
etvqttedqilkrdmppafikvenactklvraaqmlqadpysvpardylidgsrgilsgt
sdllltfdeaevrkiirvckgileyltvaevvetmedlvtytknlgpgmtkmakmiderq
qelthqehrvmlvnsmntvkellpvlisamkifvttkntksqgieealknrnftvekmsa
eineiirvlqltswd

  • Chain 'B':
    No sequence available.