PDB entry 1t00

View 1t00 on RCSB PDB site
Description: The structure of thioredoxin from S. coelicolor
Class: electron transport
Keywords: thioredoxin, S. coelicolor, redox regulation, Multifunction macromolecule, ELECTRON TRANSPORT
Deposited on 2004-04-07, released 2005-01-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: 0.176
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: STREPTOMYCES COELICOLOR [TaxId:100226]
    Gene: TRXA, SCO3889, SCH24.11C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52230 (2-111)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d1t00a1, d1t00a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1t00A (A:)
shmagtlkhvtddsfeqdvlkndkpvlvdfwaawcgpcrqiapsleaiaaeygdkieivk
lnidenpgtaakygvmsiptlnvyqggevaktivgakpkaaivrdledfiad