PDB entry 1szx

View 1szx on RCSB PDB site
Description: Role Of Hydrogen Bonding In The Active Site Of Human Manganese Superoxide Dismutase
Class: oxidoreductase
Keywords: mnsod manganese superoxide dismutase, oxidoreductase
Deposited on 2004-04-06, released 2004-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.242
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (33)
      • engineered (122)
    Domains in SCOPe 2.07: d1szxa1, d1szxa2
  • Chain 'B':
    Compound: Superoxide dismutase [Mn], mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04179 (0-197)
      • engineered (33)
      • engineered (122)
    Domains in SCOPe 2.07: d1szxb1, d1szxb2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1szxA (A:)
    khslpdlpydygalephinaqimqlhhskhhaafvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgfgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1szxB (B:)
    khslpdlpydygalephinaqimqlhhskhhaafvnnlnvteekyqealakgdvtaqial
    qpalkfnggghinhsifwtnlspngggepkgelleaikrdfgsfdkfkekltaasvgvqg
    sgfgwlgfnkerghlqiaacpnqdplqgttglipllgidvwehayylqyknvrpdylkai
    wnvinwenvterymackk