PDB entry 1szr

View 1szr on RCSB PDB site
Description: a dimer interface mutant of ornithine decarboxylase reveals structure of gem diamine intermediate
Deposited on 2004-04-06, released 2004-10-26
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-26, with a file datestamp of 2004-10-26.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.244
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1szrA (A:)
    gamdivvnddlscrflegfntrdalckkismntcdegdpffvadlgdivrkhetwkkclp
    rvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigvppekiiyanpckqishi
    ryardsgvdvmtfdcvdelekvakthpkakmvlristddslarcrlsvkfgakvedcrfi
    leqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhildigggfpg
    trdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaftlavnviakavtpgvq
    tdvgahaesnaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptc
    dgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvsglpdhvvrel
    ksqks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szrA (A:)
    gdpffvadlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnteiq
    rvrgigvppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlris
    tgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnm
    hildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaftlavn
    viakavtqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptcdgld
    qiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1szrB (B:)
    gamdivvnddlscrflegfntrdalckkismntcdegdpffvadlgdivrkhetwkkclp
    rvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigvppekiiyanpckqishi
    ryardsgvdvmtfdcvdelekvakthpkakmvlristddslarcrlsvkfgakvedcrfi
    leqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhildigggfpg
    trdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaftlavnviakavtpgvq
    tdvgahaesnaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptc
    dgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvsglpdhvvrel
    ksqks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szrB (B:)
    gdpffvadlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnteiq
    rvrgigvppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlris
    tkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgf
    nmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaftla
    vnviakavtqsfmyyvndgvygsfncilydhavvrplpqrepklypssvwgptcdgldqi
    veryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvsglpdhvvrel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1szrC (C:)
    gamdivvnddlscrflegfntrdalckkismntcdegdpffvadlgdivrkhetwkkclp
    rvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigvppekiiyanpckqishi
    ryardsgvdvmtfdcvdelekvakthpkakmvlristddslarcrlsvkfgakvedcrfi
    leqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhildigggfpg
    trdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaftlavnviakavtpgvq
    tdvgahaesnaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptc
    dgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvsglpdhvvrel
    ksqks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szrC (C:)
    gdpffvadlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnteiq
    rvrgigvppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlris
    tvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelg
    fnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaftl
    avnviakavtqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptcd
    gldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1szrD (D:)
    gamdivvnddlscrflegfntrdalckkismntcdegdpffvadlgdivrkhetwkkclp
    rvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigvppekiiyanpckqishi
    ryardsgvdvmtfdcvdelekvakthpkakmvlristddslarcrlsvkfgakvedcrfi
    leqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhildigggfpg
    trdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaftlavnviakavtpgvq
    tdvgahaesnaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptc
    dgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvsglpdhvvrel
    ksqks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szrD (D:)
    rflegfntrdalckkisgdpffvadlgdivrkhetwkkclprvtpfyavkcnddwrvlgt
    laalgtgfdcasnteiqrvrgigvppekiiyanpckqishiryardsgvdvmtfdcvdel
    ekvakthpkakmvlristvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfa
    qaisdsrfvfdmgtelgfnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkl
    tivaepgryyvasaftlavnviakavtpaqsfmyyvndgvygsfncilydhavvrplpqr
    epipneklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgtssfngfqs
    ptiyyvvs