PDB entry 1szr

View 1szr on RCSB PDB site
Description: A Dimer interface mutant of ornithine decarboxylase reveals structure of gem diamine intermediate
Class: lyase
Keywords: pyridoxal phosphate, PXP, ODC, ornithine decarboxylase, Lyase, gem-diamine, carbinolamine, dimer interface, beta-alpha-barrels, greek key
Deposited on 2004-04-06, released 2004-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.244
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ornithine decarboxylase
    Species: Trypanosoma brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07805
      • engineered (293)
    Domains in SCOPe 2.07: d1szra1, d1szra2
  • Chain 'B':
    Compound: ornithine decarboxylase
    Species: Trypanosoma brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07805
      • engineered (293)
    Domains in SCOPe 2.07: d1szrb1, d1szrb2
  • Chain 'C':
    Compound: ornithine decarboxylase
    Species: Trypanosoma brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07805
      • engineered (293)
    Domains in SCOPe 2.07: d1szrc1, d1szrc2
  • Chain 'D':
    Compound: ornithine decarboxylase
    Species: Trypanosoma brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07805
      • engineered (293)
    Domains in SCOPe 2.07: d1szrd1, d1szrd2
  • Heterogens: PXP, PLG, ORX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1szrA (A:)
    gamdivvnddlscrflegfntrdalckkismntcdegdpffvadlgdivrkhetwkkclp
    rvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigvppekiiyanpckqishi
    ryardsgvdvmtfdcvdelekvakthpkakmvlristddslarcrlsvkfgakvedcrfi
    leqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhildigggfpg
    trdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaftlavnviakavtpgvq
    tdvgahaesnaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptc
    dgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvsglpdhvvrel
    ksqks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szrA (A:)
    gdpffvadlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnteiq
    rvrgigvppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlris
    tgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnm
    hildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaftlavn
    viakavtqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptcdgld
    qiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1szrB (B:)
    gamdivvnddlscrflegfntrdalckkismntcdegdpffvadlgdivrkhetwkkclp
    rvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigvppekiiyanpckqishi
    ryardsgvdvmtfdcvdelekvakthpkakmvlristddslarcrlsvkfgakvedcrfi
    leqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhildigggfpg
    trdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaftlavnviakavtpgvq
    tdvgahaesnaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptc
    dgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvsglpdhvvrel
    ksqks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szrB (B:)
    gdpffvadlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnteiq
    rvrgigvppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlris
    tkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgf
    nmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaftla
    vnviakavtqsfmyyvndgvygsfncilydhavvrplpqrepklypssvwgptcdgldqi
    veryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvsglpdhvvrel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1szrC (C:)
    gamdivvnddlscrflegfntrdalckkismntcdegdpffvadlgdivrkhetwkkclp
    rvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigvppekiiyanpckqishi
    ryardsgvdvmtfdcvdelekvakthpkakmvlristddslarcrlsvkfgakvedcrfi
    leqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhildigggfpg
    trdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaftlavnviakavtpgvq
    tdvgahaesnaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptc
    dgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvsglpdhvvrel
    ksqks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szrC (C:)
    gdpffvadlgdivrkhetwkkclprvtpfyavkcnddwrvlgtlaalgtgfdcasnteiq
    rvrgigvppekiiyanpckqishiryardsgvdvmtfdcvdelekvakthpkakmvlris
    tvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelg
    fnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaftl
    avnviakavtqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptcd
    gldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1szrD (D:)
    gamdivvnddlscrflegfntrdalckkismntcdegdpffvadlgdivrkhetwkkclp
    rvtpfyavkcnddwrvlgtlaalgtgfdcasnteiqrvrgigvppekiiyanpckqishi
    ryardsgvdvmtfdcvdelekvakthpkakmvlristddslarcrlsvkfgakvedcrfi
    leqakklnidvtgvsfhvgsgstdastfaqaisdsrfvfdmgtelgfnmhildigggfpg
    trdaplkfeeiagvinnalekhfppdlkltivaepgryyvasaftlavnviakavtpgvq
    tdvgahaesnaqsfmyyvndgvygsfncilydhavvrplpqrepipneklypssvwgptc
    dgldqiveryylpemqvgewllfedmgaytvvgtssfngfqsptiyyvvsglpdhvvrel
    ksqks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szrD (D:)
    rflegfntrdalckkisgdpffvadlgdivrkhetwkkclprvtpfyavkcnddwrvlgt
    laalgtgfdcasnteiqrvrgigvppekiiyanpckqishiryardsgvdvmtfdcvdel
    ekvakthpkakmvlristvkfgakvedcrfileqakklnidvtgvsfhvgsgstdastfa
    qaisdsrfvfdmgtelgfnmhildigggfpgtrdaplkfeeiagvinnalekhfppdlkl
    tivaepgryyvasaftlavnviakavtpaqsfmyyvndgvygsfncilydhavvrplpqr
    epipneklypssvwgptcdgldqiveryylpemqvgewllfedmgaytvvgtssfngfqs
    ptiyyvvs