PDB entry 1szq

View 1szq on RCSB PDB site
Description: Crystal Structure of 2-methylcitrate dehydratase
Class: structural genomics, lyase
Keywords: Propionate catabolism, 2-methylcitric acid cycle STRUCTURAL GENOMICS TARGET, T819, NYSGXRC, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, STRUCTURAL GENOMICS, LYASE
Deposited on 2004-04-06, released 2004-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.204
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-methylcitrate dehydratase
    Species: Escherichia coli [TaxId:562]
    Gene: PRPD, B0334
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77243 (Start-482)
      • modified residue (23)
      • modified residue (94)
      • modified residue (140)
      • modified residue (147)
      • modified residue (185)
      • modified residue (237)
      • modified residue (243)
      • modified residue (277)
      • modified residue (300)
      • modified residue (306)
      • modified residue (350)
      • modified residue (471)
    Domains in SCOPe 2.07: d1szqa_
  • Chain 'B':
    Compound: 2-methylcitrate dehydratase
    Species: Escherichia coli [TaxId:562]
    Gene: PRPD, B0334
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77243 (Start-482)
      • modified residue (23)
      • modified residue (94)
      • modified residue (140)
      • modified residue (147)
      • modified residue (185)
      • modified residue (237)
      • modified residue (243)
      • modified residue (277)
      • modified residue (300)
      • modified residue (306)
      • modified residue (350)
      • modified residue (471)
    Domains in SCOPe 2.07: d1szqb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1szqA (A:)
    msaqinnirpefdreivdivdyvmnyeisskvaydtahyclldtlgcglealeypackkl
    lgpivpgtvvpngvrvpgtqfqldpvqaafnigamirwldfndtwlaaewghpsdnlggi
    latadwlsrnavasgkapltmkqvltamikaheiqgcialensfnrvgldhvllvkvast
    avvaemlgltreeilnavslawvdgqslrtyrhapntgtrkswaagdatsravrlalmak
    tgemgypsaltapvwgfydvsfkgesfrfqrpygsyvmenvlfkisfpaefhsqtaveaa
    mtlyeqmqaagktaadiekvtirtheaciriidkkgplnnpadrdhciqymvaipllfgr
    ltaadyednvaqdkridalrekincfedpaftadyhdpekraianaitleftdgtrfeev
    vveypigharrrqdgipklvdkfkinlarqfptrqqqrilevsldrarleqmpvneyldl
    yvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szqA (A:)
    efdreivdivdyvmnyeisskvaydtahyclldtlgcglealeypackkllgpivpgtvv
    pngvrvpgtqfqldpvqaafnigamirwldfndtwlaaewghpsdnlggilatadwlsrn
    avasgkapltmkqvltamikaheiqgcialensfnrvgldhvllvkvastavvaemlglt
    reeilnavslawvdgqslrtyrhapntgtrkswaagdatsravrlalmaktgemgypsal
    tapvwgfydvsfkgesfrfqrpygsyvmenvlfkisfpaefhsqtaveaamtlyeqmqaa
    gktaadiekvtirtheaciriidkkgplnnpadrdhciqymvaipllfgrltaadyednv
    aqdkridalrekincfedpaftadyhdpekraianaitleftdgtrfeevvveypighar
    rrqdgipklvdkfkinlarqfptrqqqrilevsldrarleqmpvneyldlyvi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1szqB (B:)
    msaqinnirpefdreivdivdyvmnyeisskvaydtahyclldtlgcglealeypackkl
    lgpivpgtvvpngvrvpgtqfqldpvqaafnigamirwldfndtwlaaewghpsdnlggi
    latadwlsrnavasgkapltmkqvltamikaheiqgcialensfnrvgldhvllvkvast
    avvaemlgltreeilnavslawvdgqslrtyrhapntgtrkswaagdatsravrlalmak
    tgemgypsaltapvwgfydvsfkgesfrfqrpygsyvmenvlfkisfpaefhsqtaveaa
    mtlyeqmqaagktaadiekvtirtheaciriidkkgplnnpadrdhciqymvaipllfgr
    ltaadyednvaqdkridalrekincfedpaftadyhdpekraianaitleftdgtrfeev
    vveypigharrrqdgipklvdkfkinlarqfptrqqqrilevsldrarleqmpvneyldl
    yvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szqB (B:)
    efdreivdivdyvmnyeisskvaydtahyclldtlgcglealeypackkllgpivpgtvv
    pngvrvpgtqfqldpvqaafnigamirwldfndtwlaaewghpsdnlggilatadwlsrn
    avasgkapltmkqvltamikaheiqgcialensfnrvgldhvllvkvastavvaemlglt
    reeilnavslawvdgqslrtyrhapntgtrkswaagdatsravrlalmaktgemgypsal
    tapvwgfydvsfkgesfrfqrpygsyvmenvlfkisfpaefhsqtaveaamtlyeqmqaa
    gktaadiekvtirtheaciriidkkgplnnpadrdhciqymvaipllfgrltaadyednv
    aqdkridalrekincfedpaftadyhdpekraianaitleftdgtrfeevvveypighar
    rrqdgipklvdkfkinlarqfptrqqqrilevsldrarleqmpvneyldlyvi