PDB entry 1szp

View 1szp on RCSB PDB site
Description: a crystal structure of the rad51 filament
Deposited on 2004-04-06, released 2004-07-13
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-03, with a file datestamp of 2004-08-03.
Experiment type: XRAY
Resolution: 3.25 Å
R-factor: 0.273
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1szpA (A:)
    mvpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarl
    vpmgfvtaadfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtla
    vtcqipldigggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhql
    rlldaaaqmmsesrfslivvdsvmalyrtdfsgrgelsarqmhlakfmralqrladqfgv
    avvvtnqvvaqvdggmafnpdpkkptggnimahssttrlgfkkgkgcqrlckvvdspclp
    eaecvfaiyedgvgdpreede
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szpA (A:)
    mvpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarl
    vpmgfvtaadfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtla
    vtcqipldigggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhql
    rlldaaaqmmsesrfslivvdsvmalyrtdelsarqmhlakfmralqrladqfgvavvvt
    nqvvtggnimahssttrlgfkkgkgcqrlckvvdspclpeaecvfaiyedgvgdp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1szpB (B:)
    mvpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarl
    vpmgfvtaadfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtla
    vtcqipldigggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhql
    rlldaaaqmmsesrfslivvdsvmalyrtdfsgrgelsarqmhlakfmralqrladqfgv
    avvvtnqvvaqvdggmafnpdpkkptggnimahssttrlgfkkgkgcqrlckvvdspclp
    eaecvfaiyedgvgdpreede
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szpB (B:)
    ngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarlvpmgfvtaa
    dfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtlavtcqipldi
    gggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhqlrlldaaaqm
    msesrfslivvdsvmalyrelsarqmhlakfmralqrladqfgvavvvtnqvggnimahs
    sttrlgfkkgkgcqrlckvvecvfaiyedgvgdp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1szpC (C:)
    mvpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarl
    vpmgfvtaadfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtla
    vtcqipldigggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhql
    rlldaaaqmmsesrfslivvdsvmalyrtdfsgrgelsarqmhlakfmralqrladqfgv
    avvvtnqvvaqvdggmafnpdpkkptggnimahssttrlgfkkgkgcqrlckvvdspclp
    eaecvfaiyedgvgdpreede
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szpC (C:)
    ngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarlvpmgfvtaa
    dfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtlavtcqipldi
    gggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhqlrlldaaaqm
    msesrfslivvdsvmalyrelsarqmhlakfmralqrladqfgvavvvtnqvggnimahs
    sttrlgfkkgkgcqrlckvvecvfaiyedgvgdp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1szpD (D:)
    mvpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarl
    vpmgfvtaadfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtla
    vtcqipldigggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhql
    rlldaaaqmmsesrfslivvdsvmalyrtdfsgrgelsarqmhlakfmralqrladqfgv
    avvvtnqvvaqvdggmafnpdpkkptggnimahssttrlgfkkgkgcqrlckvvdspclp
    eaecvfaiyedgvgdpreede
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szpD (D:)
    mvpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarl
    vpmgfvtaadfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtla
    vtcqipldigggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhql
    rlldaaaqmmsesrfslivvdsvmalyrtdelsarqmhlakfmralqrladqfgvavvvt
    nqvggnimahssttrlgfkkgkgcqrlckvvdspclpeaecvfaiyedgvgdp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1szpE (E:)
    mvpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarl
    vpmgfvtaadfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtla
    vtcqipldigggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhql
    rlldaaaqmmsesrfslivvdsvmalyrtdfsgrgelsarqmhlakfmralqrladqfgv
    avvvtnqvvaqvdggmafnpdpkkptggnimahssttrlgfkkgkgcqrlckvvdspclp
    eaecvfaiyedgvgdpreede
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szpE (E:)
    mvpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarl
    vpmgfvtaadfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtla
    vtcqipldigggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhql
    rlldaaaqmmsesrfslivvdsvmalyrtdfelsarqmhlakfmralqrladqfgvavvv
    tnqvggnimahssttrlgfkkgkgcqrlckvvdspclpeaecvfaiyedgvgdp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1szpF (F:)
    mvpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarl
    vpmgfvtaadfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtla
    vtcqipldigggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhql
    rlldaaaqmmsesrfslivvdsvmalyrtdfsgrgelsarqmhlakfmralqrladqfgv
    avvvtnqvvaqvdggmafnpdpkkptggnimahssttrlgfkkgkgcqrlckvvdspclp
    eaecvfaiyedgvgdpreede
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szpF (F:)
    mvpieklqvngitmadvkklresglhtaeavayaprkdlleikgiseakadkllneaarl
    vpmgfvtaadfhmrrseliclttgsknldtllgggvetgsitelfgefrtgksqlchtla
    vtcqipldigggegkclyidtegtfrpvrlvsiaqrfgldpddalnnvayaraynadhql
    rlldaaaqmmsesrfslivvdsvmalyrtdelsarqmhlakfmralqrladqfgvavvvt
    nqvtggnimahssttrlgfkkgkgcqrlckvvdspclpeaecvfaiyedgvgdp