PDB entry 1szo

View 1szo on RCSB PDB site
Description: Crystal Structure Analysis of the 6-Oxo Camphor Hydrolase His122Ala Mutant Bound to Its Natural Product (2S,4S)-alpha-Campholinic Acid
Class: hydrolase
Keywords: Enzyme-Product Complex, hydrolase
Deposited on 2004-04-06, released 2004-06-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.164
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-oxocamphor hydrolase
    Species: Rhodococcus sp. NCIMB 9784 [TaxId:157732]
    Gene: camK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93TU6
      • engineered (121)
    Domains in SCOPe 2.08: d1szoa_
  • Chain 'B':
    Compound: 6-oxocamphor hydrolase
    Species: Rhodococcus sp. NCIMB 9784 [TaxId:157732]
    Gene: camK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93TU6
      • engineered (121)
    Domains in SCOPe 2.08: d1szob_
  • Chain 'C':
    Compound: 6-oxocamphor hydrolase
    Species: Rhodococcus sp. NCIMB 9784 [TaxId:157732]
    Gene: camK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93TU6
      • engineered (121)
    Domains in SCOPe 2.08: d1szoc_
  • Chain 'D':
    Compound: 6-oxocamphor hydrolase
    Species: Rhodococcus sp. NCIMB 9784 [TaxId:157732]
    Gene: camK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93TU6
      • engineered (121)
    Domains in SCOPe 2.08: d1szod_
  • Chain 'E':
    Compound: 6-oxocamphor hydrolase
    Species: Rhodococcus sp. NCIMB 9784 [TaxId:157732]
    Gene: camK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93TU6
      • engineered (121)
    Domains in SCOPe 2.08: d1szoe_
  • Chain 'F':
    Compound: 6-oxocamphor hydrolase
    Species: Rhodococcus sp. NCIMB 9784 [TaxId:157732]
    Gene: camK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93TU6
      • engineered (121)
    Domains in SCOPe 2.08: d1szof_
  • Chain 'G':
    Compound: 6-oxocamphor hydrolase
    Species: Rhodococcus sp. NCIMB 9784 [TaxId:157732]
    Gene: camK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93TU6
      • engineered (121)
    Domains in SCOPe 2.08: d1szog_
  • Chain 'H':
    Compound: 6-oxocamphor hydrolase
    Species: Rhodococcus sp. NCIMB 9784 [TaxId:157732]
    Gene: camK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93TU6
      • engineered (121)
    Domains in SCOPe 2.08: d1szoh_
  • Chain 'I':
    Compound: 6-oxocamphor hydrolase
    Species: Rhodococcus sp. NCIMB 9784 [TaxId:157732]
    Gene: camK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93TU6
      • engineered (121)
    Domains in SCOPe 2.08: d1szoi_
  • Chain 'J':
    Compound: 6-oxocamphor hydrolase
    Species: Rhodococcus sp. NCIMB 9784 [TaxId:157732]
    Gene: camK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93TU6
      • engineered (121)
    Domains in SCOPe 2.08: d1szoj_
  • Chain 'K':
    Compound: 6-oxocamphor hydrolase
    Species: Rhodococcus sp. NCIMB 9784 [TaxId:157732]
    Gene: camK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93TU6
      • engineered (121)
    Domains in SCOPe 2.08: d1szok_
  • Chain 'L':
    Compound: 6-oxocamphor hydrolase
    Species: Rhodococcus sp. NCIMB 9784 [TaxId:157732]
    Gene: camK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93TU6
      • engineered (121)
    Domains in SCOPe 2.08: d1szol_
  • Heterogens: CA, CAX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1szoA (A:)
    mkqlatpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdre
    nkvviltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvt
    napeipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeld
    artaldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslg
    lahealaaidlgmeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szoA (A:)
    latpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkv
    viltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnap
    eipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldart
    aldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglah
    ealaaidlg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1szoB (B:)
    mkqlatpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdre
    nkvviltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvt
    napeipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeld
    artaldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslg
    lahealaaidlgmeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szoB (B:)
    latpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkv
    viltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnap
    eipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldart
    aldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglah
    ealaaidl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1szoC (C:)
    mkqlatpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdre
    nkvviltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvt
    napeipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeld
    artaldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslg
    lahealaaidlgmeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szoC (C:)
    latpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkv
    viltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnap
    eipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldart
    aldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglah
    ealaaidl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1szoD (D:)
    mkqlatpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdre
    nkvviltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvt
    napeipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeld
    artaldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslg
    lahealaaidlgmeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szoD (D:)
    kqlatpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdren
    kvviltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtn
    apeipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqelda
    rtaldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslgl
    ahealaaidlg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1szoE (E:)
    mkqlatpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdre
    nkvviltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvt
    napeipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeld
    artaldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslg
    lahealaaidlgmeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szoE (E:)
    latpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkv
    viltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnap
    eipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldart
    aldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglah
    ealaaidl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1szoF (F:)
    mkqlatpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdre
    nkvviltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvt
    napeipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeld
    artaldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslg
    lahealaaidlgmeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szoF (F:)
    atpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkvv
    iltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnape
    ipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldarta
    ldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglahe
    alaaidlg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1szoG (G:)
    mkqlatpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdre
    nkvviltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvt
    napeipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeld
    artaldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslg
    lahealaaidlgmeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szoG (G:)
    latpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkv
    viltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnap
    eipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldart
    aldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglah
    ealaaidlg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1szoH (H:)
    mkqlatpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdre
    nkvviltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvt
    napeipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeld
    artaldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslg
    lahealaaidlgmeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szoH (H:)
    latpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkv
    viltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnap
    eipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldart
    aldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglah
    ealaaidl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1szoI (I:)
    mkqlatpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdre
    nkvviltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvt
    napeipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeld
    artaldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslg
    lahealaaidlgmeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szoI (I:)
    latpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkv
    viltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnap
    eipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldart
    aldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglah
    ealaaidlg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1szoJ (J:)
    mkqlatpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdre
    nkvviltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvt
    napeipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeld
    artaldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslg
    lahealaaidlgmeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szoJ (J:)
    latpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkv
    viltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnap
    eipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldart
    aldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglah
    ealaaidlg
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1szoK (K:)
    mkqlatpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdre
    nkvviltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvt
    napeipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeld
    artaldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslg
    lahealaaidlgmeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szoK (K:)
    latpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkv
    viltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnap
    eipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldart
    aldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglah
    ealaaidlg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1szoL (L:)
    mkqlatpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdre
    nkvviltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvt
    napeipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeld
    artaldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslg
    lahealaaidlgmeseq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szoL (L:)
    atpfqeysqkyenirlerdggvllvtvhtegkslvwtstahdelaycfhdiacdrenkvv
    iltgtgpsfcneidftsfnlgtphdwdeiifegqrllnnllsievpviaavngpvtnape
    ipvmsdivlaaesatfqdgphfpsgivpgdgahvvwphvlgsnrgryflltgqeldarta
    ldygavnevlseqellprawelargiaekpllarryarkvltrqlrrvmeadlslglahe
    alaaidlg