PDB entry 1szn

View 1szn on RCSB PDB site
Description: the structure of alpha-galactosidase
Deposited on 2004-04-06, released 2004-08-10
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-10, with a file datestamp of 2004-08-10.
Experiment type: XRAY
Resolution: 1.54 Å
R-factor: 0.153
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sznA (A:)
    ivmpdgvtgkvpslgwnswnayhcdideskflsaaelivssglldagynyvniddcwsmk
    dgrvdghiapnatrfpdgidglakkvhalglklgiystagtatcagypaslgyedvdaad
    fadwgvdylkydncnvpsdwqdeyvacnpdfvktgpngtcttaldptlappgydwstsks
    aerfgamrnalakqsheivlsmciwgqadvfswgnstgiswrmsddispnwgsvtrilnl
    nsfklnsvdfwghndadmlevgngnltaaetrthfalwaamksplligtdlaqlsqnnin
    llknkhllafnqdsvygqpatpykwginpdwtfnvtypaefwagpsskghlvlmvntldi
    tatkeakwneipglsaghyevrdvwsdkdlgclssykaavaahdtavilvgkkcqrw