PDB entry 1szj

View 1szj on RCSB PDB site
Description: structure of holo-glyceraldehyde-3-phosphate-dehydrogenase from palinurus versicolor refined 2.0 angstrom resolution
Class: oxidoreductase
Keywords: oxidoreductase, d-glyceraldehyde-3-phosphate-dehydrogenase, molecular symmetry, allosterism
Deposited on 1997-02-04, released 1998-09-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.168
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: d-glyceraldehyde-3-phosphate-dehydrogenase
    Species: Palinurus versicolor [TaxId:82835]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1szjg1, d1szjg2
  • Chain 'R':
    Compound: d-glyceraldehyde-3-phosphate-dehydrogenase
    Species: Palinurus versicolor [TaxId:82835]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1szjr1, d1szjr2
  • Heterogens: SO4, NAD, HOH

PDB Chain Sequences:

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1szjG (G:)
    skigingfgrigrlvlraalemgaqvvavndpfialeymvymfkydsthgmfkgevkaed
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
    sadapmfvcgvnlekyskdmkvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpnvsvvd
    ltvrlgkecsyddikaamkaasegplqgvlgyteddvvscdftgdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidlikhmqkvdsa
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1szjR (R:)
    skigingfgrigrlvlraalemgaqvvavndpfialeymvymfkydsthgmfkgevkaed
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
    sadapmfvcgvnlekyskdmkvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpnvsvvd
    ltvrlgkecsyddikaamkaasegplqgvlgyteddvvscdftgdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidlikhmqkvdsa