PDB entry 1szj

View 1szj on RCSB PDB site
Description: structure of holo-glyceraldehyde-3-phosphate-dehydrogenase from palinurus versicolor refined 2.0 angstrom resolution
Deposited on 1997-02-04, released 1998-09-16
The last revision prior to the SCOP 1.65 freeze date was dated 1998-09-16, with a file datestamp of 1998-09-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.168
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1szjG (G:)
    skigingfgrigrlvlraalemgaqvvavndpfialeymvymfkydsthgmfkgevkaed
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
    sadapmfvcgvnlekyskdmkvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpnvsvvd
    ltvrlgkecsyddikaamkaasegplqgvlgyteddvvscdftgdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidlikhmqkvdsa
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1szjR (R:)
    skigingfgrigrlvlraalemgaqvvavndpfialeymvymfkydsthgmfkgevkaed
    galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
    sadapmfvcgvnlekyskdmkvvsnascttnclapvakvlhenfeiveglmttvhavtat
    qktvdgpsakdwrggrgaaqniipsstgaakavgkvipeldgkltgmafrvptpnvsvvd
    ltvrlgkecsyddikaamkaasegplqgvlgyteddvvscdftgdnrssifdakagiqls
    ktfvkvvswydnefgysqrvidlikhmqkvdsa