PDB entry 1szi

View 1szi on RCSB PDB site
Description: Crystal Structure of the C-terminus of TIP47
Class: lipid binding, peptide binding
Keywords: 4-helix bundle, alpha/beta domain, PAT protein, LIPID BINDING, PEPTIDE BINDING
Deposited on 2004-04-05, released 2004-07-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mannose-6-phosphate receptor binding protein 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1szia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sziA (A:)
    sgvdrvlvkseawadnrlplteaelaliatppedsdmaslqqqrqeqnyfvrlgslserl
    rnhayehslgklqnarqkaqetlqqltsvlglmesvkqgvdqrlgegqeklhqmwlswnq
    ktpqdaekdpakpeqvearalsmfrditqqlqsmcvalgasiqglpshvreqaqqarsqv
    ndlqatfsgihsfqdlsagvlaqtreriararealdntveyvaqntpamwlvgpfapgit
    ektpegk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sziA (A:)
    nrlplteaelaliatppedsdmaslqqqrqeqnyfvrlgslserlrnhayehslgklqna
    rqkaqetlqqltsvlglmesvkqakpeqvearalsmfrditqqlqsmcvalgasiqglps
    hvreqaqqarsqvndlqatfsgihsfqdlsagvlaqtreriararealdntveyvaqntp
    amwlvgpfapgite