PDB entry 1szh

View 1szh on RCSB PDB site
Description: Crystal Structure of C. elegans HER-1
Class: signaling protein
Keywords: extended 3-10 helix; left-handed anti-parallel 4-helix bundle, overhand 3-helix bundle, SIGNALING PROTEIN
Deposited on 2004-04-05, released 2004-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.209
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Her-1 protein
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: HER-1, ZK287.8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P34704 (4-End)
      • cloning artifact (3)
      • expression tag (83)
      • engineered (148)
      • engineered (83)
    Domains in SCOPe 2.07: d1szha1, d1szha2
  • Chain 'B':
    Compound: Her-1 protein
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: HER-1, ZK287.8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P34704
      • expression tag (83)
      • engineered (83)
    Domains in SCOPe 2.07: d1szhb_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1szhA (A:)
    gssstltkelikdaaekcctrnrqeccieimkfgtpircgydrdpklpgyvykclqnvlf
    akepkkkinlddsvccsvfgndqedsgrrcenrcknlmtspsidaatrldsikscslldn
    vlykcfekcrslrkdgikievlqfeeyceatfiqkrtfrgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szhA (A:)
    stltkelikdaaekcctrnrqeccieimkfgtpircgydrdpklpgyvykclqnvlfake
    pkkkinlddsvccsvfgndqedsgrrcenrcknlmtspsidaatrldsikscslldnvly
    kcfekcrslrkdgikievlqfeeycea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1szhB (B:)
    gssstltkelikdaaekcctrnrqeccieimkfgtpircgydrdpklpgyvykclqnvlf
    akepkkkinlddsvccsvfgndqedsgrrcenrcknlmtspsidaatrldsikscslldn
    vlykcfekcrslrkdgikievlqfeeyceatfiqkrtfrgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szhB (B:)
    ltkelikdaaekcctrnrqeccieimkfgtpircgydrdpklpgyvykclqnvlfakepk
    kkinlddsvccsvfgndqedsgrrcenrcknlmtspsidaatrldsikscslldnvlykc
    fekcrslrkdgikievlqfeeyc