PDB entry 1szg

View 1szg on RCSB PDB site
Description: A198G:L230A flavocytochrome b2 with sulfite bound
Deposited on 2004-04-05, released 2004-07-27
The last revision prior to the SCOP 1.71 freeze date was dated 2004-07-27, with a file datestamp of 2004-07-27.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.225
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1szga_
  • Chain 'B':
    Domains in SCOP 1.71: d1szgb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1szgA (A:)
    epkldmnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvta
    ifeplhapnvidkyiapekklgplqgsmppelvcppyapgetkediarkeqlksllppld
    niinlydfeylasqtltkqawayyssgandevthrenhnayhriffkpkilvdvrkvdis
    tdmlgshvdvpfyvsatglcklgnplegekdvargcgqgvtkvpqmistaascspeeiie
    aapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtvdapslgqrekdmklkfsnt
    kagpkamkktnveesqgasralskfidpsltwkdieelkkktklpivikgvqrtedvika
    aeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlk
    alclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldl
    stlkartvgvpndvlynevyegptltefeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szgA (A:)
    getkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthrenhn
    ayhriffkpkilvdvrkvdistdmlgshvdvpfyvsatglcklgnplegekdvargcgqg
    vtkvpqmistaascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfv
    tvdapslgqrekdmklkfsntalskfidpsltwkdieelkkktklpivikgvqrtedvik
    aaeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvl
    kalclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlld
    lstlkartvgvpndvlynevyegptltefeda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1szgB (B:)
    epkldmnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvta
    ifeplhapnvidkyiapekklgplqgsmppelvcppyapgetkediarkeqlksllppld
    niinlydfeylasqtltkqawayyssgandevthrenhnayhriffkpkilvdvrkvdis
    tdmlgshvdvpfyvsatglcklgnplegekdvargcgqgvtkvpqmistaascspeeiie
    aapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtvdapslgqrekdmklkfsnt
    kagpkamkktnveesqgasralskfidpsltwkdieelkkktklpivikgvqrtedvika
    aeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlk
    alclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldl
    stlkartvgvpndvlynevyegptltefeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szgB (B:)
    tkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthrenhnay
    hriffkpkilvdvrkvdistdmlgshvdvpfyvsatglcklgnplegekdvargcgqgvt
    kvpqmistaascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtv
    dapslgqrekdmklkfsnskfidpsltwkdieelkkktklpivikgvqrtedvikaaeig
    vsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlkalcl
    gakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldlstlk
    artvgvpndvlynevyegptltefeda