PDB entry 1szf

View 1szf on RCSB PDB site
Description: A198G:L230A mutant flavocytochrome b2 with pyruvate bound
Deposited on 2004-04-05, released 2004-07-27
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-27, with a file datestamp of 2004-07-27.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.222
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1szfa_
  • Chain 'B':
    Domains in SCOP 1.69: d1szfb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1szfA (A:)
    epkldmnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvta
    ifeplhapnvidkyiapekklgplqgsmppelvcppyapgetkediarkeqlksllppld
    niinlydfeylasqtltkqawayyssgandevthrenhnayhriffkpkilvdvrkvdis
    tdmlgshvdvpfyvsatglcklgnplegekdvargcgqgvtkvpqmistaascspeeiie
    aapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtvdapslgqrekdmklkfsnt
    kagpkamkktnveesqgasralskfidpsltwkdieelkkktklpivikgvqrtedvika
    aeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlk
    alclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldl
    stlkartvgvpndvlynevyegptltefeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szfA (A:)
    getkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthrenhn
    ayhriffkpkilvdvrkvdistdmlgshvdvpfyvsatglcklgnplegekdvargcgqg
    vtkvpqmistaascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfv
    tvdapslgqrekdmklkfsngasralskfidpsltwkdieelkkktklpivikgvqrted
    vikaaeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgt
    dvlkalclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpd
    lldlstlkartvgvpndvlynevyegptltefeda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1szfB (B:)
    epkldmnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvta
    ifeplhapnvidkyiapekklgplqgsmppelvcppyapgetkediarkeqlksllppld
    niinlydfeylasqtltkqawayyssgandevthrenhnayhriffkpkilvdvrkvdis
    tdmlgshvdvpfyvsatglcklgnplegekdvargcgqgvtkvpqmistaascspeeiie
    aapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtvdapslgqrekdmklkfsnt
    kagpkamkktnveesqgasralskfidpsltwkdieelkkktklpivikgvqrtedvika
    aeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlk
    alclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldl
    stlkartvgvpndvlynevyegptltefeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szfB (B:)
    getkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthrenhn
    ayhriffkpkilvdvrkvdistdmlgshvdvpfyvsatglcklgnplegekdvargcgqg
    vtkvpqmistaascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfv
    tvdapslgqrekdmklkfalskfidpsltwkdieelkkktklpivikgvqrtedvikaae
    igvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlkal
    clgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldlst
    lkartvgvpndvlynevyegptltefeda