PDB entry 1szf

View 1szf on RCSB PDB site
Description: A198G:L230A mutant flavocytochrome b2 with pyruvate bound
Class: oxidoreductase
Keywords: flavocytochrome; L-lactate dehydrogenase; pyruvate, OXIDOREDUCTASE
Deposited on 2004-04-05, released 2004-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.222
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome b2, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CYB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00175 (Start-510)
      • engineered (197)
      • engineered (229)
    Domains in SCOPe 2.07: d1szfa_
  • Chain 'B':
    Compound: Cytochrome b2, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CYB2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00175 (Start-510)
      • engineered (197)
      • engineered (229)
    Domains in SCOPe 2.07: d1szfb_
  • Heterogens: FMN, PYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1szfA (A:)
    epkldmnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvta
    ifeplhapnvidkyiapekklgplqgsmppelvcppyapgetkediarkeqlksllppld
    niinlydfeylasqtltkqawayyssgandevthrenhnayhriffkpkilvdvrkvdis
    tdmlgshvdvpfyvsatglcklgnplegekdvargcgqgvtkvpqmistaascspeeiie
    aapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtvdapslgqrekdmklkfsnt
    kagpkamkktnveesqgasralskfidpsltwkdieelkkktklpivikgvqrtedvika
    aeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlk
    alclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldl
    stlkartvgvpndvlynevyegptltefeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szfA (A:)
    getkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthrenhn
    ayhriffkpkilvdvrkvdistdmlgshvdvpfyvsatglcklgnplegekdvargcgqg
    vtkvpqmistaascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfv
    tvdapslgqrekdmklkfsngasralskfidpsltwkdieelkkktklpivikgvqrted
    vikaaeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgt
    dvlkalclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpd
    lldlstlkartvgvpndvlynevyegptltefeda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1szfB (B:)
    epkldmnkqkispaevakhnkpddcwvvingyvydltrflpnhpggqdvikfnagkdvta
    ifeplhapnvidkyiapekklgplqgsmppelvcppyapgetkediarkeqlksllppld
    niinlydfeylasqtltkqawayyssgandevthrenhnayhriffkpkilvdvrkvdis
    tdmlgshvdvpfyvsatglcklgnplegekdvargcgqgvtkvpqmistaascspeeiie
    aapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfvtvdapslgqrekdmklkfsnt
    kagpkamkktnveesqgasralskfidpsltwkdieelkkktklpivikgvqrtedvika
    aeigvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlk
    alclgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldl
    stlkartvgvpndvlynevyegptltefeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szfB (B:)
    getkediarkeqlksllppldniinlydfeylasqtltkqawayyssgandevthrenhn
    ayhriffkpkilvdvrkvdistdmlgshvdvpfyvsatglcklgnplegekdvargcgqg
    vtkvpqmistaascspeeiieaapsdkqiqwyqlyvnsdrkitddlvknveklgvkalfv
    tvdapslgqrekdmklkfalskfidpsltwkdieelkkktklpivikgvqrtedvikaae
    igvsgvvlsnhggrqldfsrapievlaetmpileqrnlkdklevfvdggvrrgtdvlkal
    clgakgvglgrpflyanscygrngvekaieilrdeiemsmrllgvtsiaelkpdlldlst
    lkartvgvpndvlynevyegptltefeda