PDB entry 1szb

View 1szb on RCSB PDB site
Description: Crystal structure of the human MBL-associated protein 19 (MAp19)
Deposited on 2004-04-05, released 2004-06-22
The last revision prior to the SCOP 1.71 freeze date was dated 2004-07-27, with a file datestamp of 2004-07-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.261
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1szbA (A:)
    tplgpkwpepvfgrlaspgfpgeyandqerrwtltappgyrlrlyfthfdlelshlceyd
    fvklssgakvlatlcgqestdterapgkdtfyslgsslditfrsdysnekpftgfeafya
    aedidecqvapgeaptcdhhchnhlggfycscragyvlhrnkrtcseqsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szbA (A:)
    plgpkwpepvfgrlaspgfpgeyandqerrwtltappgyrlrlyfthfdlelshlceydf
    vklssgakvlatlcgqestdterapgkdtfyslgsslditfrsdysnekpftgfeafyaa
    edidecqvapgeaptcdhhchnhlggfycscragyvlhrnkrtcseq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1szbB (B:)
    tplgpkwpepvfgrlaspgfpgeyandqerrwtltappgyrlrlyfthfdlelshlceyd
    fvklssgakvlatlcgqestdterapgkdtfyslgsslditfrsdysnekpftgfeafya
    aedidecqvapgeaptcdhhchnhlggfycscragyvlhrnkrtcseqsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szbB (B:)
    lgpkwpepvfgrlaspgfpgeyandqerrwtltappgyrlrlyfthfdlelshlceydfv
    klssgakvlatlcgqestdterapgkdtfyslgsslditfrsdysnekpftgfeafyaae
    didecqvapgeaptcdhhchnhlggfycscragyvlhrnkrtcseq