PDB entry 1szb

View 1szb on RCSB PDB site
Description: Crystal structure of the human MBL-associated protein 19 (MAp19)
Class: protein binding
Keywords: calcium, complement, innate immunity, cub, egf, protein binding
Deposited on 2004-04-05, released 2004-06-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.261
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mannose binding lectin-associated serine protease-2 related protein, MAp19 (19kDa)
    Species: Homo sapiens [TaxId:9606]
    Gene: MASP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1szba1, d1szba2
  • Chain 'B':
    Compound: mannose binding lectin-associated serine protease-2 related protein, MAp19 (19kDa)
    Species: Homo sapiens [TaxId:9606]
    Gene: MASP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1szbb1, d1szbb2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1szbA (A:)
    tplgpkwpepvfgrlaspgfpgeyandqerrwtltappgyrlrlyfthfdlelshlceyd
    fvklssgakvlatlcgqestdterapgkdtfyslgsslditfrsdysnekpftgfeafya
    aedidecqvapgeaptcdhhchnhlggfycscragyvlhrnkrtcseqsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szbA (A:)
    plgpkwpepvfgrlaspgfpgeyandqerrwtltappgyrlrlyfthfdlelshlceydf
    vklssgakvlatlcgqestdterapgkdtfyslgsslditfrsdysnekpftgfeafyaa
    edidecqvapgeaptcdhhchnhlggfycscragyvlhrnkrtcseq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1szbB (B:)
    tplgpkwpepvfgrlaspgfpgeyandqerrwtltappgyrlrlyfthfdlelshlceyd
    fvklssgakvlatlcgqestdterapgkdtfyslgsslditfrsdysnekpftgfeafya
    aedidecqvapgeaptcdhhchnhlggfycscragyvlhrnkrtcseqsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szbB (B:)
    lgpkwpepvfgrlaspgfpgeyandqerrwtltappgyrlrlyfthfdlelshlceydfv
    klssgakvlatlcgqestdterapgkdtfyslgsslditfrsdysnekpftgfeafyaae
    didecqvapgeaptcdhhchnhlggfycscragyvlhrnkrtcseq