PDB entry 1sza

View 1sza on RCSB PDB site
Description: The RNA polymerase II CTD in mRNA processing: beta-turn recognition and beta-spiral model
Class: transcription
Keywords: Pcf11, RNA polymerase II CTD interacting domain, arm repeats, phosphoserine, TRANSCRIPTION
Deposited on 2004-04-05, released 2004-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PCF11 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PCF11, YDR228C, YD9934.13C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39081 (0-143)
      • cloning artifact (140-143)
    Domains in SCOPe 2.07: d1szaa1, d1szaa2
  • Chain 'B':
    Compound: PCF11 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PCF11, YDR228C, YD9934.13C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39081
      • cloning artifact (140-142)
    Domains in SCOPe 2.07: d1szab1, d1szab2
  • Chain 'C':
    Compound: PCF11 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PCF11, YDR228C, YD9934.13C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39081
      • cloning artifact (140)
    Domains in SCOPe 2.07: d1szac1, d1szac2
  • Chain 'Z':
    Compound: CTD-peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1SZA (Start-13)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1szaA (A:)
    mdhdtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqk
    lyafyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtgl
    plfegsalekieqflikasaaale
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1szaB (B:)
    mdhdtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqk
    lyafyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtgl
    plfegsalekieqflikasaaale
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szaB (B:)
    dtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqklya
    fyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtglplf
    egsalekieqflikasaaal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1szaC (C:)
    mdhdtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqk
    lyafyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtgl
    plfegsalekieqflikasaaale
    

    Sequence, based on observed residues (ATOM records): (download)
    >1szaC (C:)
    dhdtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqkl
    yafyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtglp
    lfegsalekieqflikasaa
    

  • Chain 'Z':
    No sequence available.