PDB entry 1sz9

View 1sz9 on RCSB PDB site
Description: The RNA polymerase II CTD in mRNA processing: beta-turn recognition and beta-spiral model
Class: transcription
Keywords: Pcf11, RNA polymerase II CTD interacting domain, arm repeats, TRANSCRIPTION
Deposited on 2004-04-05, released 2004-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PCF11 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PCF11, YDR228C, YD9934.13C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39081 (Start-143)
      • cloning artifact (140-143)
    Domains in SCOPe 2.07: d1sz9a1, d1sz9a2
  • Chain 'B':
    Compound: PCF11 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PCF11, YDR228C, YD9934.13C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39081 (Start-143)
      • cloning artifact (140-143)
    Domains in SCOPe 2.07: d1sz9b1, d1sz9b2
  • Chain 'C':
    Compound: PCF11 protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PCF11, YDR228C, YD9934.13C
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39081
      • cloning artifact (140)
    Domains in SCOPe 2.07: d1sz9c1, d1sz9c2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sz9A (A:)
    mdhdtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqk
    lyafyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtgl
    plfegsalekieqflikasaaale
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sz9A (A:)
    dhdtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqkl
    yafyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtglp
    lfegsalekieqflikasaaale
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sz9B (B:)
    mdhdtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqk
    lyafyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtgl
    plfegsalekieqflikasaaale
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sz9B (B:)
    dhdtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqkl
    yafyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtglp
    lfegsalekieqflikasaaale
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sz9C (C:)
    mdhdtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqk
    lyafyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtgl
    plfegsalekieqflikasaaale
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sz9C (C:)
    dhdtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqkl
    yafyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtglp
    lfegsalekieqflikasaa