PDB entry 1sz9

View 1sz9 on RCSB PDB site
Description: the rna polymerase ii ctd in mrna processing: beta-turn recognition and beta-spiral model
Deposited on 2004-04-05, released 2004-07-13
The last revision prior to the SCOP 1.71 freeze date was dated 2004-07-13, with a file datestamp of 2004-07-13.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.22
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1sz9a_
  • Chain 'B':
    Domains in SCOP 1.71: d1sz9b_
  • Chain 'C':
    Domains in SCOP 1.71: d1sz9c_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sz9A (A:)
    mdhdtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqk
    lyafyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtgl
    plfegsalekieqflikasaaale
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sz9A (A:)
    dhdtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqkl
    yafyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtglp
    lfegsalekieqflikasaaale
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sz9B (B:)
    mdhdtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqk
    lyafyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtgl
    plfegsalekieqflikasaaale
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sz9B (B:)
    dhdtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqkl
    yafyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtglp
    lfegsalekieqflikasaaale
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sz9C (C:)
    mdhdtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqk
    lyafyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtgl
    plfegsalekieqflikasaaale
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sz9C (C:)
    dhdtevivkdfnsileeltfnsrpiittltklaeeniscaqyfvdaiesriekcmpkqkl
    yafyaldsicknvgspytiyfsrnlfnlykrtyllvdnttrtklinmfklwlnpndtglp
    lfegsalekieqflikasaa