PDB entry 1sz8

View 1sz8 on RCSB PDB site
Description: Crystal Structure of an Acidic Phospholipase A2 from Naja Naja Sagittifera at 1.5 A resolution
Class: hydrolase
Keywords: Phospholipase A2, molecular conformation, enzyme activity, HYDROLASE
Deposited on 2004-04-05, released 2004-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-04-16, with a file datestamp of 2014-04-11.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.192
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 isoform 3
    Species: Naja sagittifera [TaxId:195058]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sz8a_
  • Heterogens: CA, PO4, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sz8A (A:)
    nlyqfknmiqctvpsrswqdfadygcycgkggsgtpvddldrccqvhdncyneaenisgc
    rpyfktysyectqgtltckgdnnacaasvcdcdrlaaicfagapyndanynidlkarcn