PDB entry 1sz2

View 1sz2 on RCSB PDB site
Description: Crystal structure of E. coli glucokinase in complex with glucose
Class: transferase
Keywords: glucokinase, ATP-dependent, glucose binding, transferase
Deposited on 2004-04-02, released 2004-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.197
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucokinase
    Species: Escherichia coli [TaxId:562]
    Gene: GLK, B2388, Z3654, ECS3268
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6V8 (Start-331)
      • modified residue (84)
      • modified residue (96)
      • modified residue (116)
      • modified residue (120)
      • modified residue (251)
    Domains in SCOPe 2.07: d1sz2a2, d1sz2a3
  • Chain 'B':
    Compound: Glucokinase
    Species: Escherichia coli [TaxId:562]
    Gene: GLK, B2388, Z3654, ECS3268
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6V8 (12-331)
      • modified residue (84)
      • modified residue (96)
      • modified residue (116)
      • modified residue (120)
      • modified residue (251)
    Domains in SCOPe 2.07: d1sz2b2, d1sz2b3
  • Heterogens: BGC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sz2A (A:)
    mgsshhhhhhgstkyalvgdvggtnarlalcdiasgeisqaktysgldypsleavirvyl
    eehkvevkdgciaiacpitgdwvamtnhtwafsiaemkknlgfshleiindftavsmaip
    mlkkehliqfggaepvegkpiavygagtglgvahlvhvdkrwvslpgegghvdfapnsee
    eaiileilraeighvsaervlsgpglvnlyraivkadnrlpenlkpkditeraladsctd
    crralslfcvimgrfggnlalnlgtfggvfiaggivprfleffkasgfraafedkgrfke
    yvhdipvylivhdnpgllgsgahlrqtlghil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sz2A (A:)
    kyalvgdvggtnarlalcdiasgeisqaktysgldypsleavirvyleehkvevkdgcia
    iacpitgdwvamtnhtwafsiaemkknlgfshleiindftavsmaipmlkkehliqfgga
    epvegkpiavygagtglgvahlvhvdkrwvslpgegghvdfapnseeeaiileilraeig
    hvsaervlsgpglvnlyraivkadnrlpenlkpkditeraladsctdcrralslfcvimg
    rfggnlalnlgtfggvfiaggivprfleffkasgfraafedkgrfkeyvhdipvylivhd
    npgllgsgahlrqtlghil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sz2B (B:)
    mgsshhhhhhgstkyalvgdvggtnarlalcdiasgeisqaktysgldypsleavirvyl
    eehkvevkdgciaiacpitgdwvamtnhtwafsiaemkknlgfshleiindftavsmaip
    mlkkehliqfggaepvegkpiavygagtglgvahlvhvdkrwvslpgegghvdfapnsee
    eaiileilraeighvsaervlsgpglvnlyraivkadnrlpenlkpkditeraladsctd
    crralslfcvimgrfggnlalnlgtfggvfiaggivprfleffkasgfraafedkgrfke
    yvhdipvylivhdnpgllgsgahlrqtlghil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sz2B (B:)
    tkyalvgdvggtnarlalcdiasgeisqaktysgldypsleavirvyleehkvevkdgci
    aiacpitgdwvamtnhtwafsiaemkknlgfshleiindftavsmaipmlkkehliqfgg
    aepvegkpiavygagtglgvahlvhvdkrwvslpgegghvdfapnseeeaiileilraei
    ghvsaervlsgpglvnlyraivkadnrlpenlkpkditeraladsctdcrralslfcvim
    grfggnlalnlgtfggvfiaggivprfleffkasgfraafedkgrfkeyvhdipvylivh
    dnpgllgsgahlrqtlghil