PDB entry 1sz1

View 1sz1 on RCSB PDB site
Description: Mechanism of CCA-adding enzymes specificity revealed by crystal structures of ternary complexes
Class: transferase/RNA
Keywords: CCA-adding enzyme, specificity, tRNA, complex
Deposited on 2004-04-02, released 2004-08-10
The last revision prior to the SCOP 1.73 freeze date was dated 2004-08-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 6.21 Å
R-factor: 0.361
AEROSPACI score: -0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA nucleotidyltransferase
    Species: Archaeoglobus fulgidus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1sz1a1, d1sz1a2, d1sz1a3
  • Chain 'B':
    Compound: tRNA nucleotidyltransferase
    Species: Archaeoglobus fulgidus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1sz1b1, d1sz1b2, d1sz1b3
  • Chain 'E':
    Compound: t-RNA (76-mer)
  • Chain 'F':
    Compound: t-RNA (76-mer)

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sz1A (A:)
    mkveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgslei
    dvfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkep
    kniksavdrtpfhhkwlegrikgkenevrllkgflkangiygaeykvrgfsgylcelliv
    fygsfletvknarrwtrrtvidvakgevrkgeeffvvdpvdekrnvaanlsldnlarfvh
    lcrefmeapslgffkpkhpleieperlrkiveergtavfavkfrkpdivddnlypqlera
    srkifeflerenfmplrsafkaseefcyllfecqikeisrvfrrmgpqfedernvkkfls
    rnrafrpfiengrwwafemrkfttpeegvrsyasthwhtlgknvgesireyfeiisgekl
    fkepvtaelcemmgvkd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sz1B (B:)
    mkveeilekalelvipdeeevrkgreaeeelrrrldelgveyvfvgsyarntwlkgslei
    dvfllfpeefskeelrergleigkavldsyeiryaehpyvhgvvkgvevdvvpcyklkep
    kniksavdrtpfhhkwlegrikgkenevrllkgflkangiygaeykvrgfsgylcelliv
    fygsfletvknarrwtrrtvidvakgevrkgeeffvvdpvdekrnvaanlsldnlarfvh
    lcrefmeapslgffkpkhpleieperlrkiveergtavfavkfrkpdivddnlypqlera
    srkifeflerenfmplrsafkaseefcyllfecqikeisrvfrrmgpqfedernvkkfls
    rnrafrpfiengrwwafemrkfttpeegvrsyasthwhtlgknvgesireyfeiisgekl
    fkepvtaelcemmgvkd
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.