PDB entry 1sz0

View 1sz0 on RCSB PDB site
Description: N-terminal 3 domains of CI-MPR bound to mannose 6-phosphate
Class: protein transport,sugar binding protein
Keywords: lectin; receptor; mannose 6-phosphate, PROTEIN TRANSPORT,SUGAR BINDING PROTEIN
Deposited on 2004-04-01, released 2004-06-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.238
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cation-Independent Mannose 6-phosphate receptor
    Species: Bos taurus [TaxId:9913]
    Gene: IGF2R, M6P
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sz0a1, d1sz0a2, d1sz0a3
  • Chain 'B':
    Compound: Cation-Independent Mannose 6-phosphate receptor
    Species: Bos taurus [TaxId:9913]
    Gene: IGF2R, M6P
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1sz0b1, d1sz0b2, d1sz0b3
  • Heterogens: NAG, OS, M6P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sz0A (A:)
    aagtqgaefpelcsytweavdtknnmlykinicgnmgvaqcgpssavcmhdlktdsfhsv
    gdsllktasrsllefnttvnckqqnhkiqssitflcgktlgtpefvtatdcvhyfewrtt
    aackknifkankevpcyafdrelkkhdlnpliktsgaylvddsdpdtslfinvcrdievl
    rasspqvrvcptgaaaclvrgdrafdvgrpqeglklvsndrlvlsyvkegagqpdfcdgh
    spavtitfvcpserregtipkltaksncrfeiewvteyachrdylesrscslssaqhdva
    vdlqplsrveasdslfytseadeytyylsicggsqapicnkkdaavcqvkkadstqvkva
    grpqnltlrysdgdltliyfggeecssgfqrmsvinfecnqtagnngrgapvftgevdct
    yfftwdtkyacv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sz0A (A:)
    aefpelcsytweavdtknnmlykinicgnmgvaqcgpssavcmhdlktdsfhsvgdsllk
    tasrsllefnttvnckiqssitflcgktlgtpefvtatdcvhyfewrttaackknifkan
    kevpcyafdrelkkhdlnpliktsgaylvddsdpdtslfinvcrdievlrasspqvrvcp
    tgaaaclvrgdrafdvgrpqeglklvsndrlvlsyvkegagqpdfcdghspavtitfvcp
    serregtipkltaksncrfeiewvteyachrdylesrscslssaqhdvavdlqplssdsl
    fytseadeytyylsicggsqapicnkkdaavcqvkkadstqvkvagrpqnltlrysdgdl
    tliyfggeecssgfqrmsvinfecnqtagnngrgapvftgevdctyfftwdtkyacv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sz0B (B:)
    aagtqgaefpelcsytweavdtknnmlykinicgnmgvaqcgpssavcmhdlktdsfhsv
    gdsllktasrsllefnttvnckqqnhkiqssitflcgktlgtpefvtatdcvhyfewrtt
    aackknifkankevpcyafdrelkkhdlnpliktsgaylvddsdpdtslfinvcrdievl
    rasspqvrvcptgaaaclvrgdrafdvgrpqeglklvsndrlvlsyvkegagqpdfcdgh
    spavtitfvcpserregtipkltaksncrfeiewvteyachrdylesrscslssaqhdva
    vdlqplsrveasdslfytseadeytyylsicggsqapicnkkdaavcqvkkadstqvkva
    grpqnltlrysdgdltliyfggeecssgfqrmsvinfecnqtagnngrgapvftgevdct
    yfftwdtkyacv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sz0B (B:)
    aefpelcsytweavdtknnmlykinicgnmgvaqcgpssavcmhdlktdsfhsvgdsllk
    tasrsllefnttvnckkiqssitflcgktlgtpefvtatdcvhyfewrttaackknifka
    nkevpcyafdrelkkhdlnpliktsgaylvddsdpdtslfinvcrdievlrasspqvrvc
    ptgaaaclvrgdrafdvgrpqeglklvsndrlvlsyvkpdfcdghspavtitfvcpserr
    egtipkltaksncrfeiewvteyachrdylesrscslssaqhdvavdlqplsrvasdslf
    ytseadeytyylsicggsqapicnkkdaavcqvkkadstqvkvagrpqnltlrysdgdlt
    liyfggeecssgfqrmsvinfecnqtagnngrgapvftgevdctyfftwdtkyacv