PDB entry 1syx

View 1syx on RCSB PDB site
Description: The crystal structure of a binary U5 snRNP complex
Class: translation/immune system
Keywords: GYF-domain; thioredoxin-like; spliceosomal proteins, TRANSLATION-IMMUNE SYSTEM COMPLEX
Deposited on 2004-04-02, released 2005-10-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.218
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Spliceosomal U5 snRNP-specific 15 kDa protein
    Species: Homo sapiens [TaxId:9606]
    Gene: U5-15KD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1syxa_
  • Chain 'B':
    Compound: CD2 antigen cytoplasmic tail-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CD2BP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1syxb1
  • Chain 'C':
    Compound: Spliceosomal U5 snRNP-specific 15 kDa protein
    Species: Homo sapiens [TaxId:9606]
    Gene: U5-15KD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1syxc_
  • Chain 'D':
    Compound: CD2 antigen cytoplasmic tail-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CD2BP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1syxd1
  • Chain 'E':
    Compound: Spliceosomal U5 snRNP-specific 15 kDa protein
    Species: Homo sapiens [TaxId:9606]
    Gene: U5-15KD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1syxe_
  • Chain 'F':
    Compound: CD2 antigen cytoplasmic tail-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CD2BP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1syxf1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1syxA (A:)
    msymlphlhngwqvdqailseedrvvvirfghdwdptcmkmdevlysiaekvknfaviyl
    vditevpdfnkmyelydpctvmfffrnkhimidlgtgnnnkinwamedkqemvdiietvy
    rgarkgrglvvspkdystkyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1syxA (A:)
    ymlphlhngwqvdqailseedrvvvirfghdwdptcmkmdevlysiaekvknfaviylvd
    itevpdfnkmyelydpctvmfffrnkhimidlgtgnnnkinwamedkqemvdiietvyrg
    arkgrglvvspkdys
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1syxB (B:)
    aeeeletptptqrgeaesrgdglvdvmweykwentgdaelygpftsaqmqtwvsegyfpd
    gvycrkldppggqfynskridfdlyt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1syxB (B:)
    dvmweykwentgdaelygpftsaqmqtwvsegyfpdgvycrkldppggqfynskridfdl
    yt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1syxC (C:)
    msymlphlhngwqvdqailseedrvvvirfghdwdptcmkmdevlysiaekvknfaviyl
    vditevpdfnkmyelydpctvmfffrnkhimidlgtgnnnkinwamedkqemvdiietvy
    rgarkgrglvvspkdystkyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1syxC (C:)
    ymlphlhngwqvdqailseedrvvvirfghdwdptcmkmdevlysiaekvknfaviylvd
    itevpdfnkmyelydpctvmfffrnkhimidlgtgnnnkinwamedkqemvdiietvyrg
    arkgrglvvspkdys
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1syxD (D:)
    aeeeletptptqrgeaesrgdglvdvmweykwentgdaelygpftsaqmqtwvsegyfpd
    gvycrkldppggqfynskridfdlyt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1syxD (D:)
    dvmweykwentgdaelygpftsaqmqtwvsegyfpdgvycrkldppggqfynskridfdl
    yt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1syxE (E:)
    msymlphlhngwqvdqailseedrvvvirfghdwdptcmkmdevlysiaekvknfaviyl
    vditevpdfnkmyelydpctvmfffrnkhimidlgtgnnnkinwamedkqemvdiietvy
    rgarkgrglvvspkdystkyry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1syxE (E:)
    ymlphlhngwqvdqailseedrvvvirfghdwdptcmkmdevlysiaekvknfaviylvd
    itevpdfnkmyelydpctvmfffrnkhimidlgtgnnnkinwamedkqemvdiietvyrg
    arkgrglvvspkdys
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1syxF (F:)
    aeeeletptptqrgeaesrgdglvdvmweykwentgdaelygpftsaqmqtwvsegyfpd
    gvycrkldppggqfynskridfdlyt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1syxF (F:)
    dvmweykwentgdaelygpftsaqmqtwvsegyfpdgvycrkldppggqfynskridfdl
    yt