PDB entry 1sym

View 1sym on RCSB PDB site
Description: 3-d solution structure of reduced apo-s100b from rat, nmr, 20 structures
Class: calcium-binding protein
Keywords: metal-binding, calcium-binding protein
Deposited on 1996-05-29, released 1996-12-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s100b
    Species: Rattus norvegicus [TaxId:10116]
    Gene: S100BETA FROM RATTUS NORVEGICU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1syma_
  • Chain 'B':
    Compound: s100b
    Species: Rattus norvegicus [TaxId:10116]
    Gene: S100BETA FROM RATTUS NORVEGICU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1symb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1symA (A:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldedgdgecdfqefmafvsmvttacheffehe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1symB (B:)
    mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
    ldedgdgecdfqefmafvsmvttacheffehe