PDB entry 1syk

View 1syk on RCSB PDB site
Description: Crystal structure of E230Q mutant of cAMP-dependent protein kinase reveals unexpected apoenzyme conformation
Class: transferase
Keywords: E230Q mutant; Catalytic Subunit; cAMP-dependent Protein Kinase; apoenzyme conformation; N-terminal A-helix, TRANSFERASE
Deposited on 2004-04-01, released 2005-05-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase, alpha-catalytic subunit
    Species: Mus musculus [TaxId:10090]
    Gene: Prkaca, Pkaca
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05132 (0-349)
      • modified residue (196)
      • engineered (229)
      • modified residue (337)
    Domains in SCOPe 2.07: d1syka_
  • Chain 'B':
    Compound: cAMP-dependent protein kinase, alpha-catalytic subunit
    Species: Mus musculus [TaxId:10090]
    Gene: Prkaca, Pkaca
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05132 (Start-349)
      • modified residue (196)
      • engineered (229)
      • modified residue (337)
    Domains in SCOPe 2.07: d1sykb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sykA (A:)
    gnaaaakkgseqesvkeflakakedflkkwetpsqntaqldqfdriktlgtgsfgrvmlv
    khkesgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
    eyvaggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
    qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyqmaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sykB (B:)
    gnaaaakkgseqesvkeflakakedflkkwetpsqntaqldqfdriktlgtgsfgrvmlv
    khkesgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
    eyvaggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
    qvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyqmaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sykB (B:)
    esvkeflakakedflkkwetpsqntaqldqfdriktlgtgsfgrvmlvkhkesgnhyamk
    ildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvaggemfshl
    rrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvk
    grtwtlcgtpeylapeiilskgynkavdwwalgvliyqmaagyppffadqpiqiyekivs
    gkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkvea
    pfipkeeeeirvsinekcgkeftef