PDB entry 1syb

View 1syb on RCSB PDB site
Description: transfer of a beta-turn structure to a new protein context
Deposited on 1994-01-07, released 1994-07-31
The last revision prior to the SCOP 1.57 freeze date was dated 1994-07-31, with a file datestamp of 1994-08-02.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.16
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1syb__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1syb_ (-)
klhkepatlikaidgdtvklmssngspmtfrlllvdtpetkhpkkgvekygpeasaftkk
mvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqh
lrkseaqakkeklniws