PDB entry 1sy3

View 1sy3 on RCSB PDB site
Description: 1.00 A Crystal Structure of D30N Mutant of Nitrophorin 4 from Rhodnius Prolixus Complexed with Nitric Oxide
Class: Transport protein
Keywords: lipocalin, beta barrel, ferrous heme, nitric oxide
Deposited on 2004-03-31, released 2004-06-08
The last revision prior to the SCOP 1.73 freeze date was dated 2004-06-08, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.143
AEROSPACI score: 0.99 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nitrophorin 4
  Species: Rhodnius prolixus
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q94734 (0-183)
    • engineered (29)
  Domains in SCOP 1.73: d1sy3a_
• Heterogens: PO4, HEM, NO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sy3A (A:)
  actknaiaqtgfnkdkyfngdvwyvtdylnlepddvpkrycaalaagtasgklkealyhy
  dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
  tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
  lltk