PDB entry 1sy2

View 1sy2 on RCSB PDB site
Description: 1.0 A Crystal Structure of D129A/L130A Mutant of Nitrophorin 4
Class: Transport protein
Keywords: lipocalin, beta barrel, ferric heme, Transport protein
Deposited on 2004-03-31, released 2004-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.156
AEROSPACI score: 0.97 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrophorin 4
    Species: Rhodnius prolixus [TaxId:13249]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q94734 (0-183)
      • engineered (128-129)
    Domains in SCOPe 2.07: d1sy2a_
  • Heterogens: NH4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sy2A (A:)
    actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
    dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
    tclhkgnkaagdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
    lltk