PDB entry 1sxy

View 1sxy on RCSB PDB site
Description: 1.07 A Crystal Structure of D30N Mutant of Nitrophorin 4 from Rhodnius Prolixus
Class: Transport protein
Keywords: lipocalin, beta barrel, ferric heme, Transport protein
Deposited on 2004-03-31, released 2004-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.07 Å
R-factor: 0.151
AEROSPACI score: 0.91 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nitrophorin 4
  Species: Rhodnius prolixus [TaxId:13249]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q94734 (0-183)
    • engineered (29)
  Domains in SCOPe 2.08: d1sxya_
• Heterogens: NH4, HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sxyA (A:)
  actknaiaqtgfnkdkyfngdvwyvtdylnlepddvpkrycaalaagtasgklkealyhy
  dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
  tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
  lltk